F206056

General Info

Members Datasets Scaffolds Average Seq Length
149 112 149 162

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10001049|Ga0157380_100010492
Length 184
Sequence VEPAEEIRPATYDPPVSPSPLLTPLAAAALHVGDPERILQIECGDGDGPLFLAREFPSARVRGADRSADAVHAAAARVGLDPEGRVAFKQGGPRSLPFPDDHFDLLAALDARPSPGESLRVLRPGGFLVLAESHRRDAPAGFGGRLLRRRLRRAGFDPIWAQPAGDGSFSVFRLGNGETAPRGV

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
26 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
53 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
54 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
55 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
56 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
57 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
58 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
59 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
60 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
61 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
62 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
63 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
64 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
65 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
66 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
67 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
68 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
69 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
70 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
71 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
72 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
73 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
74 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
75 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
76 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
77 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
78 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
79 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
80 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
81 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
82 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
97 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
98 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
101 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
102 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
103 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
104 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
105 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
109 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
110 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
111 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
112 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.34
Nodule 0
Rhizoplane 7.38
Rhizosphere 87.25
Stem 0
Stem Tuber 0
Unclassified 4.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100006210 3300005329 Bacteria 10018
2 Ga0070680_100301451 3300005336 Bacteria 1359
3 Ga0068868_100001866 3300005338 Bacteria 14467
4 Ga0070691_10000135 3300005341 Bacteria 22871
5 Ga0070691_10000143 3300005341 Bacteria 22475
6 Ga0070674_100000005 3300005356 Bacteria 168443
7 Ga0070667_101010252 3300005367 Bacteria 776
8 Ga0070714_100411477 3300005435 Unclassified 1280
9 Ga0070700_100086824 3300005441 Bacteria 2032
10 Ga0070663_100001051 3300005455 Bacteria 15108
11 Ga0070681_10325384 3300005458 Bacteria 1447
12 Ga0070679_100016735 3300005530 Bacteria 7085
13 Ga0070684_100084129 3300005535 Bacteria 2819
14 Ga0068853_100661682 3300005539 Bacteria 995
15 Ga0070704_100114694 3300005549 Bacteria 2057
16 Ga0068857_100313645 3300005577 Bacteria 1447
17 Ga0068852_100000056 3300005616 Bacteria 76111
18 Ga0068866_10000262 3300005718 Bacteria 24827
19 Ga0068861_100047889 3300005719 Bacteria 3229
20 Ga0068863_100016436 3300005841 Bacteria 7099
21 Ga0068863_100584635 3300005841 Bacteria 1104
22 Ga0068858_100054344 3300005842 Bacteria 3703
23 Ga0068860_101035193 3300005843 Bacteria 839
24 Ga0070712_100008158 3300006175 Bacteria 6576
25 Ga0068865_100000069 3300006881 Bacteria 53927
26 Ga0105247_10000305 3300009101 Bacteria 44071
27 Ga0105247_10235332 3300009101 Bacteria 1245
28 Ga0157371_10012052 3300013102 Bacteria 6627
29 Ga0157378_10005546 3300013297 Bacteria 11048
30 Ga0157378_10115691 3300013297 Bacteria 2465
31 Ga0157378_10119254 3300013297 Bacteria 2430
32 Ga0157372_10000204 3300013307 Bacteria 65798
33 Ga0157375_10002264 3300013308 Bacteria 16666
34 Ga0163163_10535416 3300014325 Bacteria 1234
35 Ga0157380_10001049 3300014326 Bacteria 17675
36 Ga0157377_10253120 3300014745 Bacteria 1142
37 Ga0157377_10477631 3300014745 Bacteria 866
38 Ga0157376_10011717 3300014969 Bacteria 6476
39 Ga0207642_10000354 3300025899 Bacteria 13777
40 Ga0207642_10040235 3300025899 Bacteria 2038
41 Ga0207710_10000157 3300025900 Bacteria 72764
42 Ga0207710_10273218 3300025900 Bacteria 849
43 Ga0207707_10443321 3300025912 Unclassified 1111
44 Ga0207693_10017228 3300025915 Bacteria 5761
45 Ga0207693_10150739 3300025915 Bacteria 1829
46 Ga0207652_10002832 3300025921 Bacteria 14548
47 Ga0207686_10107753 3300025934 Bacteria 1873
48 Ga0207669_10000006 3300025937 Bacteria 176348
49 Ga0207669_10054143 3300025937 Bacteria 2422
50 Ga0207704_10000049 3300025938 Bacteria 83173
51 Ga0207661_10004648 3300025944 Bacteria 9616
52 Ga0207661_10243853 3300025944 Bacteria 1595
53 Ga0207712_10000058 3300025961 Bacteria 140948
54 Ga0207668_10269940 3300025972 Unclassified 1390
55 Ga0207703_10408215 3300026035 Bacteria 1261
56 Ga0207639_10454042 3300026041 Bacteria 1164
57 Ga0207678_10004187 3300026067 Bacteria 12947
58 Ga0207641_10011905 3300026088 Bacteria 7136
59 Ga0207641_10528508 3300026088 Bacteria 1148
60 Ga0207675_100078038 3300026118 Bacteria 3102
61 Ga0207698_10000101 3300026142 Bacteria 54530
62 Ga0268266_10542558 3300028379 Bacteria 1113
63 Ga0268264_10900624 3300028381 Bacteria 888
64 Ga0495592_0117118 3300046454 Bacteria 1879
65 Ga0495603_0000596 3300046455 Bacteria 20312
66 Ga0495629_0002489 3300046459 Bacteria 14130
67 Ga0495629_0003930 3300046459 Bacteria 11175
68 Ga0495639_0100445 3300046475 Bacteria 1365
69 Ga0495594_0000030 3300046499 Bacteria 66443
70 Ga0495610_0050207 3300046512 Bacteria 2038
71 Ga0495630_0000075 3300046517 Bacteria 77378
72 Ga0495640_0024479 3300046533 Bacteria 4391
73 Ga0495622_0000080 3300046557 Bacteria 85557
74 Ga0495634_0000031 3300046642 Bacteria 110396
75 Ga0495635_0300020 3300046663 Bacteria 1077
76 Ga0495674_0000030 3300047319 Bacteria 115975
77 Ga0495676_0000805 3300047321 Bacteria 26189
78 Ga0495676_0103977 3300047321 Bacteria 2096
79 Ga0495680_0042614 3300047322 Bacteria 3600
80 Ga0495602_0602250 3300048088 Bacteria 756
81 Ga0496100_0000001 3300048903 Bacteria 530179
82 Ga0496101_0000004 3300048904 Bacteria 331599
83 Ga0496102_0492057 3300048905 Bacteria 1148
84 Ga0496103_0015343 3300048906 Bacteria 4557
85 Ga0496103_0017113 3300048906 Bacteria 4335
86 Ga0496104_0000015 3300048907 Bacteria 374530
87 Ga0496105_0000004 3300048908 Bacteria 475798
88 Ga0496106_0000076 3300048909 Bacteria 79088
89 Ga0496107_0000005 3300048910 Bacteria 281747
90 Ga0496114_0612567 3300048917 Unclassified 960
91 Ga0496115_0000162 3300048918 Bacteria 62522
92 Ga0496116_0000176 3300048919 Bacteria 128426
93 Ga0496117_0107626 3300048920 Bacteria 1746
94 Ga0496118_0096586 3300048921 Bacteria 2013
95 Ga0496119_0002021 3300048922 Bacteria 22972
96 Ga0496119_0012335 3300048922 Bacteria 6952
97 Ga0496121_0217113 3300048924 Unclassified 1350
98 Ga0501031_0001129 3300049568 Bacteria 16227
99 Ga0501032_0001889 3300049569 Bacteria 16548
100 Ga0501033_0001429 3300049570 Bacteria 21198
101 Ga0501034_0045739 3300049571 Bacteria 4421
102 Ga0501036_0001887 3300049572 Bacteria 16280
103 Ga0501037_0000985 3300049573 Bacteria 21110
104 Ga0501038_0002804 3300049574 Bacteria 16230
105 Ga0501039_0016006 3300049575 Bacteria 5743
106 Ga0501040_0044721 3300049576 Bacteria 3019
107 Ga0501042_0016081 3300049578 Bacteria 5134
108 Ga0501042_0171088 3300049578 Bacteria 1567
109 Ga0501043_0002678 3300049579 Bacteria 14939
110 Ga0501043_0100314 3300049579 Bacteria 2276
111 Ga0501046_0002843 3300049580 Bacteria 16106
112 Ga0501047_0000430 3300049581 Bacteria 46649
113 Ga0501047_0008425 3300049581 Bacteria 9727
114 Ga0501047_0071337 3300049581 Bacteria 3343
115 Ga0501047_0248598 3300049581 Bacteria 1627
116 Ga0501048_0001723 3300049582 Bacteria 16662
117 Ga0501048_0197492 3300049582 Bacteria 1426
118 Ga0501067_0165556 3300049583 Bacteria 1231
119 Ga0501068_0013769 3300049584 Bacteria 4609
120 Ga0501068_0082558 3300049584 Bacteria 1974
121 Ga0501069_0009217 3300049585 Bacteria 5206
122 Ga0501070_0000592 3300049586 Bacteria 33029
123 Ga0501070_0193616 3300049586 Bacteria 1670
124 Ga0501070_1258744 3300049586 Bacteria 566
125 Ga0501071_0809383 3300049587 Bacteria 722
126 Ga0501073_0005921 3300049589 Bacteria 9129
127 Ga0501074_0057597 3300049590 Bacteria 2799
128 Ga0501074_0145735 3300049590 Bacteria 1693
129 Ga0501074_0383889 3300049590 Bacteria 996
130 Ga0501079_0006383 3300049741 Bacteria 8853
131 Ga0501079_0016857 3300049741 Bacteria 5578
132 Ga0501080_0017371 3300049742 Bacteria 6652
133 Ga0501080_0092751 3300049742 Bacteria 2804
134 Ga0501080_0759942 3300049742 Unclassified 852
135 Ga0501083_0005790 3300049744 Bacteria 8752
136 Ga0501083_0009461 3300049744 Bacteria 6883
137 Ga0501083_0048400 3300049744 Bacteria 2869
138 Ga0501035_0001710 3300049822 Bacteria 22170
139 Ga0501044_0002472 3300049823 Bacteria 21084
140 Ga0501044_0008570 3300049823 Bacteria 11202
141 Ga0501044_0649609 3300049823 Unclassified 944
142 Ga0501045_0082032 3300049824 Bacteria 2378
143 Ga0501045_0100874 3300049824 Bacteria 2137
144 Ga0500566_0013791 3300053094 Bacteria 4755
145 Ga0500595_035921 3300053119 Bacteria 1628
146 Ga0501084_1406481 3300054114 Unclassified 584
147 Ga0501082_0010118 3300060353 Bacteria 8119
148 Ga0501082_0187043 3300060353 Bacteria 1802
149 Ga0501082_1244578 3300060353 Unclassified 650

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047322 Ga0495680_0042614 Ga0495680_0042614_19_474 151
2 3300049568 Ga0501031_0001129 Ga0501031_0001129_11791_12282 151
3 3300049569 Ga0501032_0001889 Ga0501032_0001889_11987_12478 151
4 3300049570 Ga0501033_0001429 Ga0501033_0001429_11619_12110 151
5 3300049571 Ga0501034_0045739 Ga0501034_0045739_727_1218 151
6 3300049572 Ga0501036_0001887 Ga0501036_0001887_3938_4429 151
7 3300049573 Ga0501037_0000985 Ga0501037_0000985_11652_12143 151
8 3300049574 Ga0501038_0002804 Ga0501038_0002804_4075_4566 151
9 3300049575 Ga0501039_0016006 Ga0501039_0016006_4461_4952 151
10 3300049576 Ga0501040_0044721 Ga0501040_0044721_939_1430 151
11 3300049578 Ga0501042_0016081 Ga0501042_0016081_2453_2944 151
12 3300049579 Ga0501043_0002678 Ga0501043_0002678_4298_4789 151
13 3300049580 Ga0501046_0002843 Ga0501046_0002843_3969_4460 151
14 3300049581 Ga0501047_0000430 Ga0501047_0000430_11647_12138 151
15 3300049582 Ga0501048_0001723 Ga0501048_0001723_11875_12366 151
16 3300049583 Ga0501067_0165556 Ga0501067_0165556_644_1135 151
17 3300049584 Ga0501068_0013769 Ga0501068_0013769_181_672 151
18 3300049586 Ga0501070_0000592 Ga0501070_0000592_28233_28724 151
19 3300049589 Ga0501073_0005921 Ga0501073_0005921_4300_4791 151
20 3300049590 Ga0501074_0383889 Ga0501074_0383889_443_934 151
21 3300049741 Ga0501079_0006383 Ga0501079_0006383_4032_4523 151
22 3300049742 Ga0501080_0017371 Ga0501080_0017371_2294_2785 151
23 3300049744 Ga0501083_0005790 Ga0501083_0005790_4345_4836 151
24 3300049822 Ga0501035_0001710 Ga0501035_0001710_17610_18101 151
25 3300049823 Ga0501044_0002472 Ga0501044_0002472_6442_6933 151
26 3300049824 Ga0501045_0082032 Ga0501045_0082032_1132_1623 151
27 3300060353 Ga0501082_0010118 Ga0501082_0010118_4338_4829 151
28 3300005356 Ga0070674_100000005 Ga0070674_10000000560 152
29 3300005718 Ga0068866_10000262 Ga0068866_1000026220 152
30 3300025899 Ga0207642_10000354 Ga0207642_1000035413 152
31 3300025934 Ga0207686_10107753 Ga0207686_101077532 152
32 3300025937 Ga0207669_10000006 Ga0207669_10000006134 152
33 3300046642 Ga0495634_0000031 Ga0495634_0000031_62535_62996 152
34 3300046663 Ga0495635_0300020 Ga0495635_0300020_175_636 152
35 3300025915 Ga0207693_10150739 Ga0207693_101507393 153
36 3300048907 Ga0496104_0000015 Ga0496104_0000015_318494_318958 153
37 3300048908 Ga0496105_0000004 Ga0496105_0000004_156841_157305 153
38 3300048922 Ga0496119_0012335 Ga0496119_0012335_4440_4904 153
39 3300049824 Ga0501045_0100874 Ga0501045_0100874_315_779 153
40 3300054114 Ga0501084_1406481 Ga0501084_1406481_83_547 153
41 3300060353 Ga0501082_1244578 Ga0501082_1244578_131_595 153
42 3300046512 Ga0495610_0050207 Ga0495610_0050207_1444_1947 154
43 3300005341 Ga0070691_10000143 Ga0070691_100001439 155
44 3300005341 Ga0070691_10000135 Ga0070691_100001353 156
45 3300005336 Ga0070680_100301451 Ga0070680_1003014511 161
46 3300005455 Ga0070663_100001051 Ga0070663_10000105110 161
47 3300005458 Ga0070681_10325384 Ga0070681_103253842 161
48 3300005530 Ga0070679_100016735 Ga0070679_1000167353 161
49 3300025912 Ga0207707_10443321 Ga0207707_104433212 161
50 3300025921 Ga0207652_10002832 Ga0207652_100028328 161
51 3300025944 Ga0207661_10243853 Ga0207661_102438532 161
52 3300026067 Ga0207678_10004187 Ga0207678_100041878 161
53 3300048906 Ga0496103_0015343 Ga0496103_0015343_757_1245 161
54 3300048919 Ga0496116_0000176 Ga0496116_0000176_36266_36754 161
55 3300048920 Ga0496117_0107626 Ga0496117_0107626_1073_1561 161
56 3300048921 Ga0496118_0096586 Ga0496118_0096586_1107_1595 161
57 3300048922 Ga0496119_0002021 Ga0496119_0002021_5627_6115 161
58 3300048924 Ga0496121_0217113 Ga0496121_0217113_28_516 161
59 3300049579 Ga0501043_0100314 Ga0501043_0100314_36_524 161
60 3300049581 Ga0501047_0008425 Ga0501047_0008425_5884_6372 161
61 3300049581 Ga0501047_0071337 Ga0501047_0071337_1701_2189 161
62 3300049581 Ga0501047_0248598 Ga0501047_0248598_324_812 161
63 3300049582 Ga0501048_0197492 Ga0501048_0197492_287_775 161
64 3300049584 Ga0501068_0082558 Ga0501068_0082558_143_631 161
65 3300049585 Ga0501069_0009217 Ga0501069_0009217_1262_1750 161
66 3300049586 Ga0501070_0193616 Ga0501070_0193616_156_644 161
67 3300049586 Ga0501070_1258744 Ga0501070_1258744_61_549 161
68 3300049587 Ga0501071_0809383 Ga0501071_0809383_15_503 161
69 3300049590 Ga0501074_0057597 Ga0501074_0057597_1169_1657 161
70 3300049590 Ga0501074_0145735 Ga0501074_0145735_1171_1659 161
71 3300049741 Ga0501079_0016857 Ga0501079_0016857_3263_3751 161
72 3300049742 Ga0501080_0092751 Ga0501080_0092751_2001_2489 161
73 3300049742 Ga0501080_0759942 Ga0501080_0759942_60_578 161
74 3300049744 Ga0501083_0009461 Ga0501083_0009461_2976_3494 161
75 3300049744 Ga0501083_0048400 Ga0501083_0048400_1057_1545 161
76 3300049823 Ga0501044_0008570 Ga0501044_0008570_9016_9504 161
77 3300049823 Ga0501044_0649609 Ga0501044_0649609_184_702 161
78 3300053119 Ga0500595_035921 Ga0500595_035921_749_1237 161
79 3300060353 Ga0501082_0187043 Ga0501082_0187043_63_581 161
80 3300025961 Ga0207712_10000058 Ga0207712_1000005863 162
81 3300025937 Ga0207669_10054143 Ga0207669_100541432 163
82 3300046454 Ga0495592_0117118 Ga0495592_0117118_133_624 163
83 3300048088 Ga0495602_0602250 Ga0495602_0602250_68_559 163
84 3300005841 Ga0068863_100584635 Ga0068863_1005846352 164
85 3300005842 Ga0068858_100054344 Ga0068858_1000543443 164
86 3300005843 Ga0068860_101035193 Ga0068860_1010351931 164
87 3300009101 Ga0105247_10235332 Ga0105247_102353322 164
88 3300014325 Ga0163163_10535416 Ga0163163_105354162 164
89 3300025900 Ga0207710_10273218 Ga0207710_102732182 164
90 3300026035 Ga0207703_10408215 Ga0207703_104082152 164
91 3300026088 Ga0207641_10528508 Ga0207641_105285082 164
92 3300028381 Ga0268264_10900624 Ga0268264_109006242 164
93 3300046533 Ga0495640_0024479 Ga0495640_0024479_3000_3500 164
94 3300047319 Ga0495674_0000030 Ga0495674_0000030_69973_70473 164
95 3300048905 Ga0496102_0492057 Ga0496102_0492057_428_922 164
96 3300048906 Ga0496103_0017113 Ga0496103_0017113_264_758 164
97 3300025900 Ga0207710_10000157 Ga0207710_1000015710 165
98 3300005719 Ga0068861_100047889 Ga0068861_1000478893 167
99 3300009101 Ga0105247_10000305 Ga0105247_1000030514 167
100 3300013297 Ga0157378_10115691 Ga0157378_101156912 167
101 3300026118 Ga0207675_100078038 Ga0207675_1000780384 167
102 3300005329 Ga0070683_100006210 Ga0070683_10000621010 168
103 3300005338 Ga0068868_100001866 Ga0068868_10000186617 168
104 3300005367 Ga0070667_101010252 Ga0070667_1010102521 168
105 3300005435 Ga0070714_100411477 Ga0070714_1004114772 168
106 3300005441 Ga0070700_100086824 Ga0070700_1000868243 168
107 3300005535 Ga0070684_100084129 Ga0070684_1000841293 168
108 3300005539 Ga0068853_100661682 Ga0068853_1006616821 168
109 3300005549 Ga0070704_100114694 Ga0070704_1001146943 168
110 3300005577 Ga0068857_100313645 Ga0068857_1003136452 168
111 3300005616 Ga0068852_100000056 Ga0068852_10000005658 168
112 3300005841 Ga0068863_100016436 Ga0068863_1000164367 168
113 3300006175 Ga0070712_100008158 Ga0070712_1000081584 168
114 3300006881 Ga0068865_100000069 Ga0068865_10000006920 168
115 3300013102 Ga0157371_10012052 Ga0157371_100120522 168
116 3300013297 Ga0157378_10005546 Ga0157378_100055467 168
117 3300013297 Ga0157378_10119254 Ga0157378_101192542 168
118 3300013307 Ga0157372_10000204 Ga0157372_1000020433 168
119 3300013308 Ga0157375_10002264 Ga0157375_100022648 168
120 3300014326 Ga0157380_10001049 Ga0157380_100010492 168
121 3300014745 Ga0157377_10253120 Ga0157377_102531202 168
122 3300014745 Ga0157377_10477631 Ga0157377_104776312 168
123 3300014969 Ga0157376_10011717 Ga0157376_100117172 168
124 3300025899 Ga0207642_10040235 Ga0207642_100402352 168
125 3300025915 Ga0207693_10017228 Ga0207693_100172284 168
126 3300025938 Ga0207704_10000049 Ga0207704_1000004931 168
127 3300025944 Ga0207661_10004648 Ga0207661_1000464810 168
128 3300025972 Ga0207668_10269940 Ga0207668_102699402 168
129 3300026041 Ga0207639_10454042 Ga0207639_104540422 168
130 3300026088 Ga0207641_10011905 Ga0207641_100119057 168
131 3300026142 Ga0207698_10000101 Ga0207698_1000010158 168
132 3300028379 Ga0268266_10542558 Ga0268266_105425582 168
133 3300046455 Ga0495603_0000596 Ga0495603_0000596_4353_4862 168
134 3300046459 Ga0495629_0002489 Ga0495629_0002489_6934_7443 168
135 3300046459 Ga0495629_0003930 Ga0495629_0003930_6767_7276 168
136 3300046475 Ga0495639_0100445 Ga0495639_0100445_819_1325 168
137 3300046499 Ga0495594_0000030 Ga0495594_0000030_54591_55097 168
138 3300046517 Ga0495630_0000075 Ga0495630_0000075_24716_25222 168
139 3300046557 Ga0495622_0000080 Ga0495622_0000080_19650_20156 168
140 3300047321 Ga0495676_0000805 Ga0495676_0000805_19987_20493 168
141 3300047321 Ga0495676_0103977 Ga0495676_0103977_141_650 168
142 3300048903 Ga0496100_0000001 Ga0496100_0000001_476375_476881 168
143 3300048904 Ga0496101_0000004 Ga0496101_0000004_277727_278233 168
144 3300048909 Ga0496106_0000076 Ga0496106_0000076_73565_74071 168
145 3300048910 Ga0496107_0000005 Ga0496107_0000005_53367_53873 168
146 3300048917 Ga0496114_0612567 Ga0496114_0612567_391_900 168
147 3300048918 Ga0496115_0000162 Ga0496115_0000162_10917_11426 168
148 3300049578 Ga0501042_0171088 Ga0501042_0171088_1008_1517 168
149 3300053094 Ga0500566_0013791 Ga0500566_0013791_473_982 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

39

130

0.92

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

26

140

0.88

PF13649

Methyltransf_25

Methyltransferase domain

38

126

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6f5z-assembly1.cif.gz_A complex between the haloferax volcanii trm112 methyltransferase activator and the hvo_0019 putative methyltransferase 0.8126 6 160
6ecx-assembly1.cif.gz_A stie o-mt residues 942-1257 0.8113 9 115
3l8d-assembly1.cif.gz_A-2 crystal structure of methyltransferase from bacillus thuringiensis 0.8111 7 160
8g2f-assembly1.cif.gz_A-2 crystal structure of prmt3 with compound ii710 0.8106 20 92
6hp2-assembly1.cif.gz_A crystal structure of the o-methyltransferase from the trans-at pks multienzyme c0zgq3 of brevibacillus brevis in complex with s-adenosyl-l-homocysteine 0.809 19 116
ID Description Score Start End Superfamily
af_Q4E3J0_145_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8661 20 72 3.40.50.150
af_P91387_125_346_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8498 20 114 3.40.50.150
af_Q86I59_36_332_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8389 20 114 3.40.50.150
af_Q8I556_207_508_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.838 23 92 3.40.50.150
af_Q6ZIK0_83_357_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8352 9 116 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1M3BN07-F1-model_v4 Methyltransferase domain-containing protein 0.9676 2 161
AF-A0A1M3BN07-F1-model_v4 Methyltransferase domain-containing protein 0.9445 2 161
AF-A0A640YBC0-F1-model_v4 Class I SAM-dependent methyltransferase 0.9269 6 160 GO:0008168
GO:0032259
AF-A0A7J9YVX0-F1-model_v4 Methyltransferase domain-containing protein 0.926 6 162 GO:0008168
GO:0032259
AF-A0A1Q3NH72-F1-model_v4 deleted 0.9192 6 159

Feature Viewer

pLDDT pTM Quality
89.69 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map