F205645

General Info

Members Datasets Scaffolds Average Seq Length
149 129 298 230

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_100321375|Ga0070716_1003213752
Length 257
Sequence MRSSVSSEPPFRRRLTPQSSLFFRPALIFSALLLGAGIALRDVPSAAESARSVPPPVLDTPANPQATSEVAIFAGGCFWGSPGVFQHVQGVTSAVSGYAGGAADTVHYEMVGTNTTGHAESVRITFDPRRISYGQMLQIYFSVAHNPTELNRQGLDVGSQYRSAIFPTNPEQVRIAEAYIVQLNQAHVFDGAIVTKTEPGRDFYPAEDYHQDFLTRNPNYPYIVVNDLPKIEALRRLFPDLYRPTPVLVATAAPRNR

Samples

Sample ID Description Type Environment
1 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
49 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
75 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
76 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
77 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
78 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
88 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
89 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
90 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
91 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
92 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
93 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
94 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
95 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
96 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
100 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
101 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
102 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
103 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
104 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
105 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
106 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
107 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
110 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
111 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
112 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
113 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
114 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
115 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
116 2738541293 Rhizobium sp. GV031 Isolate Unclassified
117 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
118 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
119 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
120 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
121 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
122 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
123 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
124 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
125 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
126 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
127 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
128 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
129 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.59
Metatranscriptomes 0
Isolates 11.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.36
Nodule 1.34
Rhizoplane 6.71
Rhizosphere 71.81
Stem 0
Stem Tuber 0
Unclassified 8.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070716_100321375 3300006173 Bacteria 1085
2 JGI25165J46597_1000626 3300003214 Bacteria 29548
3 Ga0055540_1010035 3300003792 Bacteria 3191
4 Ga0070683_100000895 3300005329 Bacteria 22155
5 Ga0070670_100006107 3300005331 Bacteria 10182
6 Ga0070666_10045668 3300005335 Bacteria 2936
7 Ga0070680_100388294 3300005336 Bacteria 1189
8 Ga0070682_100260818 3300005337 Bacteria 1254
9 Ga0070691_10139314 3300005341 Bacteria 1235
10 Ga0070661_100025368 3300005344 Unclassified 4259
11 Ga0070668_100011032 3300005347 Bacteria 6726
12 Ga0070671_100038598 3300005355 Unclassified 3964
13 Ga0070688_100173178 3300005365 Unclassified 1491
14 Ga0070709_10000067 3300005434 Bacteria 81079
15 Ga0070714_100321301 3300005435 Bacteria 1447
16 Ga0070705_100004304 3300005440 Bacteria 6941
17 Ga0070705_100541956 3300005440 Unclassified 890
18 Ga0070694_100069282 3300005444 Bacteria 2426
19 Ga0070663_100027414 3300005455 Unclassified 3869
20 Ga0070662_100034013 3300005457 Unclassified 3592
21 Ga0070684_100000288 3300005535 Bacteria 35083
22 Ga0070697_100562090 3300005536 Bacteria 1001
23 Ga0070696_100229108 3300005546 Bacteria 1397
24 Ga0070693_100073382 3300005547 Bacteria 2021
25 Ga0070665_100000559 3300005548 Bacteria 51888
26 Ga0070704_100326675 3300005549 Bacteria 1287
27 Ga0068855_100000526 3300005563 Bacteria 46919
28 Ga0068855_100450184 3300005563 Bacteria 1405
29 Ga0070664_100001379 3300005564 Bacteria 19350
30 Ga0070664_100276283 3300005564 Bacteria 1514
31 Ga0068863_100125831 3300005841 Bacteria 2445
32 Ga0068862_100670768 3300005844 Bacteria 1002
33 Ga0070715_10277009 3300006163 Bacteria 888
34 Ga0070712_100052475 3300006175 Bacteria 2843
35 Ga0075433_10035463 3300006852 Bacteria 4290
36 Ga0075434_100018369 3300006871 Bacteria 6754
37 Ga0079104_1000060 3300006946 Bacteria 161936
38 Ga0075435_100023197 3300007076 Bacteria 4795
39 Ga0075435_100103180 3300007076 Bacteria 2365
40 Ga0075435_100286594 3300007076 Bacteria 1406
41 Ga0099795_10087904 3300007788 Bacteria 1200
42 Ga0105245_10161970 3300009098 Bacteria 2124
43 Ga0105248_10003108 3300009177 Bacteria 18380
44 Ga0105237_10406309 3300009545 Bacteria 1366
45 Ga0105249_10000456 3300009553 Bacteria 38267
46 Ga0157371_10000075 3300013102 Bacteria 162328
47 Ga0157378_10210780 3300013297 Bacteria 1842
48 Ga0157372_10701793 3300013307 Bacteria 1177
49 Ga0157375_10151088 3300013308 Bacteria 2458
50 Ga0163163_10018752 3300014325 Bacteria 6485
51 Ga0157380_10089439 3300014326 Bacteria 2537
52 Ga0157379_10141768 3300014968 Unclassified 2166
53 Ga0209233_1000438 3300025261 Bacteria 29102
54 Ga0209051_1003706 3300025303 Bacteria 9864
55 Ga0207680_10049466 3300025903 Bacteria 2502
56 Ga0207699_10000029 3300025906 Bacteria 138968
57 Ga0207657_10135920 3300025919 Bacteria 2011
58 Ga0207659_10086435 3300025926 Unclassified 2332
59 Ga0207687_10486744 3300025927 Bacteria 1028
60 Ga0207664_10212061 3300025929 Bacteria 1676
61 Ga0207706_10052583 3300025933 Unclassified 3596
62 Ga0207665_10075940 3300025939 Bacteria 2302
63 Ga0207665_10139049 3300025939 Bacteria 1730
64 Ga0207691_10097932 3300025940 Unclassified 2621
65 Ga0207661_10001265 3300025944 Bacteria 16910
66 Ga0207679_10134475 3300025945 Bacteria 1989
67 Ga0207667_10000073 3300025949 Bacteria 174391
68 Ga0207667_10000076 3300025949 Bacteria 166704
69 Ga0207667_10000147 3300025949 Bacteria 106918
70 Ga0207667_10000166 3300025949 Bacteria 97376
71 Ga0207667_10341271 3300025949 Bacteria 1529
72 Ga0207651_10153414 3300025960 Unclassified 1796
73 Ga0207712_10001163 3300025961 Bacteria 18274
74 Ga0207668_10026757 3300025972 Bacteria 3750
75 Ga0207678_10067965 3300026067 Unclassified 3058
76 Ga0207675_100400826 3300026118 Bacteria 1352
77 Ga0209281_1000064 3300027111 Bacteria 287876
78 Ga0268266_10001034 3300028379 Bacteria 34999
79 Ga0265338_10002018 3300028800 Bacteria 31483
80 Ga0265328_10034080 3300031239 Bacteria 1886
81 Ga0265328_10043808 3300031239 Bacteria 1646
82 Ga0265327_10000384 3300031251 Bacteria 83284
83 Ga0265327_10031807 3300031251 Bacteria 2960
84 Ga0307513_10081076 3300031456 Bacteria 3345
85 Ga0307408_100238139 3300031548 Bacteria 1494
86 Ga0307508_10181797 3300031616 Bacteria 1705
87 Ga0307516_10288036 3300031730 Bacteria 1322
88 Ga0373939_0008700 3300035114 Bacteria 2496
89 Ga0373955_0116827 3300035172 Bacteria 1547
90 Ga0373961_0000430 3300035241 Bacteria 17341
91 Ga0373935_0001126 3300035692 Bacteria 14583
92 Ga0373933_0522817 3300035724 Bacteria 778
93 Ga0373937_0043330 3300036401 Bacteria 4107
94 Ga0436364_1379431 3300037853 Bacteria 1303
95 Ga0436361_0518829 3300039447 Bacteria 10804
96 Ga0436363_0085610 3300039450 Bacteria 1318
97 Ga0436363_0757077 3300039450 Bacteria 4779
98 Ga0439465_0071374 3300041413 Bacteria 1164
99 Ga0466963_0077990 3300044694 Bacteria 2239
100 Ga0495580_0006283 3300046472 Bacteria 9713
101 Ga0495606_0000041 3300046507 Bacteria 220225
102 Ga0495606_0066190 3300046507 Bacteria 2293
103 Ga0495643_0002223 3300046522 Bacteria 15765
104 Ga0495642_0042983 3300046528 Bacteria 1843
105 Ga0495649_0000022 3300046694 Bacteria 179407
106 Ga0496100_0102273 3300048903 Bacteria 1977
107 Ga0496104_0004138 3300048907 Bacteria 12597
108 Ga0496104_0944396 3300048907 Bacteria 767
109 Ga0496105_0003108 3300048908 Bacteria 12218
110 Ga0496106_0062726 3300048909 Bacteria 2823
111 Ga0496108_0006106 3300048911 Bacteria 9744
112 Ga0496110_0002215 3300048913 Bacteria 14524
113 Ga0496111_0005799 3300048914 Bacteria 7964
114 Ga0496112_0009156 3300048915 Bacteria 8894
115 Ga0496116_0005244 3300048919 Bacteria 12114
116 Ga0496117_0010280 3300048920 Bacteria 8559
117 Ga0496117_0060401 3300048920 Bacteria 2612
118 Ga0496118_0010927 3300048921 Bacteria 8928
119 Ga0496118_0285022 3300048921 Bacteria 917
120 Ga0496121_0000653 3300048924 Bacteria 64947
121 Ga0496122_0040238 3300048925 Bacteria 3718
122 Ga0496123_0021239 3300048926 Bacteria 5051
123 Ga0496124_0000754 3300048927 Bacteria 53087
124 Ga0496126_0326906 3300048929 Bacteria 1259
125 Ga0501048_0011029 3300049582 Bacteria 6741
126 nmdc:mga0n895_1078_c1 3300050512 Bacteria 19927
127 nmdc:mga0n895_179635_c1 3300050512 Bacteria 2148
128 nmdc:mga0rr50_18123_c1 3300050513 Bacteria 4721
129 nmdc:mga0rr50_63445_c1 3300050513 Bacteria 2790
130 nmdc:mga0rr50_93783_c1 3300050513 Bacteria 2343
131 nmdc:mga0a205_342306_c1 3300050515 Bacteria 1364
132 Ga0500610_0000078 3300053079 Bacteria 29228
133 2553003735 2551306416 Bacteria 6152985
134 2585847546 2585427594 Bacteria 6180594
135 2671584913 2671180115 Bacteria 5353919
136 2738803245 2738541293 Bacteria 7065685
137 2809130658 2808606415 Bacteria 4576710
138 2809149864 2808606419 Bacteria 4576925
139 2819615448 2818991449 Bacteria 5518009
140 2852619994 2852618963 Bacteria 4577824
141 2904444633 2904439833 Bacteria 5931679
142 2904534712 2904530477 Bacteria 5876334
143 2904584601 2904584206 Bacteria 6028872
144 2904591068 2904589729 Bacteria 6113573
145 2904605305 2904601388 Bacteria 5884906
146 2919048472 2919046199 Bacteria 5567169
147 2919081007 2919079590 Bacteria 5946433
148 2923512588 2923510766 Bacteria 5926163
149 2928132618 2928130867 Bacteria 5467269
150 Ga0070716_100321375
151 JGI25165J46597_1000626
152 Ga0055540_1010035
153 Ga0070683_100000895
154 Ga0070670_100006107
155 Ga0070666_10045668
156 Ga0070680_100388294
157 Ga0070682_100260818
158 Ga0070691_10139314
159 Ga0070661_100025368
160 Ga0070668_100011032
161 Ga0070671_100038598
162 Ga0070688_100173178
163 Ga0070709_10000067
164 Ga0070714_100321301
165 Ga0070705_100004304
166 Ga0070705_100541956
167 Ga0070694_100069282
168 Ga0070663_100027414
169 Ga0070662_100034013
170 Ga0070684_100000288
171 Ga0070697_100562090
172 Ga0070696_100229108
173 Ga0070693_100073382
174 Ga0070665_100000559
175 Ga0070704_100326675
176 Ga0068855_100000526
177 Ga0068855_100450184
178 Ga0070664_100001379
179 Ga0070664_100276283
180 Ga0068863_100125831
181 Ga0068862_100670768
182 Ga0070715_10277009
183 Ga0070712_100052475
184 Ga0075433_10035463
185 Ga0075434_100018369
186 Ga0079104_1000060
187 Ga0075435_100023197
188 Ga0075435_100103180
189 Ga0075435_100286594
190 Ga0099795_10087904
191 Ga0105245_10161970
192 Ga0105248_10003108
193 Ga0105237_10406309
194 Ga0105249_10000456
195 Ga0157371_10000075
196 Ga0157378_10210780
197 Ga0157372_10701793
198 Ga0157375_10151088
199 Ga0163163_10018752
200 Ga0157380_10089439
201 Ga0157379_10141768
202 Ga0209233_1000438
203 Ga0209051_1003706
204 Ga0207680_10049466
205 Ga0207699_10000029
206 Ga0207657_10135920
207 Ga0207659_10086435
208 Ga0207687_10486744
209 Ga0207664_10212061
210 Ga0207706_10052583
211 Ga0207665_10075940
212 Ga0207665_10139049
213 Ga0207691_10097932
214 Ga0207661_10001265
215 Ga0207679_10134475
216 Ga0207667_10000073
217 Ga0207667_10000076
218 Ga0207667_10000147
219 Ga0207667_10000166
220 Ga0207667_10341271
221 Ga0207651_10153414
222 Ga0207712_10001163
223 Ga0207668_10026757
224 Ga0207678_10067965
225 Ga0207675_100400826
226 Ga0209281_1000064
227 Ga0268266_10001034
228 Ga0265338_10002018
229 Ga0265328_10034080
230 Ga0265328_10043808
231 Ga0265327_10000384
232 Ga0265327_10031807
233 Ga0307513_10081076
234 Ga0307408_100238139
235 Ga0307508_10181797
236 Ga0307516_10288036
237 Ga0373939_0008700
238 Ga0373955_0116827
239 Ga0373961_0000430
240 Ga0373935_0001126
241 Ga0373933_0522817
242 Ga0373937_0043330
243 Ga0436364_1379431
244 Ga0436361_0518829
245 Ga0436363_0085610
246 Ga0436363_0757077
247 Ga0439465_0071374
248 Ga0466963_0077990
249 Ga0495580_0006283
250 Ga0495606_0000041
251 Ga0495606_0066190
252 Ga0495643_0002223
253 Ga0495642_0042983
254 Ga0495649_0000022
255 Ga0496100_0102273
256 Ga0496104_0004138
257 Ga0496104_0944396
258 Ga0496105_0003108
259 Ga0496106_0062726
260 Ga0496108_0006106
261 Ga0496110_0002215
262 Ga0496111_0005799
263 Ga0496112_0009156
264 Ga0496116_0005244
265 Ga0496117_0010280
266 Ga0496117_0060401
267 Ga0496118_0010927
268 Ga0496118_0285022
269 Ga0496121_0000653
270 Ga0496122_0040238
271 Ga0496123_0021239
272 Ga0496124_0000754
273 Ga0496126_0326906
274 Ga0501048_0011029
275 nmdc:mga0n895_1078_c1
276 nmdc:mga0n895_179635_c1
277 nmdc:mga0rr50_18123_c1
278 nmdc:mga0rr50_63445_c1
279 nmdc:mga0rr50_93783_c1
280 nmdc:mga0a205_342306_c1
281 Ga0500610_0000078
282 2553003735
283 2585847546
284 2671584913
285 2738803245
286 2809130658
287 2809149864
288 2819615448
289 2852619994
290 2904444633
291 2904534712
292 2904584601
293 2904591068
294 2904605305
295 2919048472
296 2919081007
297 2923512588
298 2928132618

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

70

224

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gwb-assembly1.cif.gz_A-2 crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 0.8433 47 181
3e0m-assembly1.cif.gz_B crystal structure of fusion protein of msra and msrb 0.8372 47 181
1nwa-assembly1.cif.gz_A structure of mycobacterium tuberculosis methionine sulfoxide reductase a in complex with protein-bound methionine 0.8357 39 181
2j89-assembly1.cif.gz_A functional and structural aspects of poplar cytosolic and plastidial type a methionine sulfoxide reductases 0.8298 40 179
3bqg-assembly1.cif.gz_A structure of the central domain (msra) of neisseria meningitidis pilb (sulfenic acid form) 0.8289 44 192
ID Description Score Start End Superfamily
af_P9WJM5_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.8564 43 181 3.30.1060.10
af_Q09859_1_167_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.8484 47 188 3.30.1060.10
af_Q5AD39_5_182_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.838 40 181 3.30.1060.10
af_B6TNT5_14_185_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.8337 40 179 3.30.1060.10
af_A4HTE0_2_175_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.8322 44 181 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A7V8NQA9-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9797 93 206 GO:0008113
AF-A0A1F4CDY9-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.975 108 206 GO:0008113
AF-A0A2R7T6Q3-F1-model_v4 deleted 0.9745 76 206
AF-A0A4Q3HRS0-F1-model_v4 deleted 0.9725 92 206
AF-A0A4Q3Q3K7-F1-model_v4 deleted 0.9721 93 206

Map