F205611

General Info

Members Datasets Scaffolds Average Seq Length
149 125 298 117

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10009547|Ga0075365_100095471
Length 135
Sequence MAERLAGHDRGMALTFSELCIDANDTELLADFWSAVLGWPRGATDEDGEIELTNPSGAPPTLLFVRVPEGKSVKNRIHIDVSPPSAAEQPAELERLLALGATHVDIGQGAQTWHVLADPEGNEFCLLRGDPTATV

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
33 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
34 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
35 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
36 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
37 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
42 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
43 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
44 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
45 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
46 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
47 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
48 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
49 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
50 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
53 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
54 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
55 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
56 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
57 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
58 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
59 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
60 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
61 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
62 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
63 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
64 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
65 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
66 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
67 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
68 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
69 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
70 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
71 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
72 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
73 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
74 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
75 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
76 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
77 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
78 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
79 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
80 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
81 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
82 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
83 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
84 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
85 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
86 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
87 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
88 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
89 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
90 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
91 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
92 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
93 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
103 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
104 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
105 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
106 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
107 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
108 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
109 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
112 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
113 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
114 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
115 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
116 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
117 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
118 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
119 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
120 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
121 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
122 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
123 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
124 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
125 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.96
Metatranscriptomes 0
Isolates 6.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.75
Nodule 0
Rhizoplane 6.04
Rhizosphere 65.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10009547 3300006038 Bacteria 5588
2 JGI25406J46586_10006223 3300003203 Bacteria 5510
3 JGI25407J50210_10108548 3300003373 Bacteria 685
4 Ga0070683_102189407 3300005329 Bacteria 531
5 Ga0070677_10292872 3300005333 Bacteria 824
6 Ga0070692_10762546 3300005345 Bacteria 657
7 Ga0070671_100643053 3300005355 Bacteria 918
8 Ga0070673_100492910 3300005364 Bacteria 1107
9 Ga0070714_100867116 3300005435 Bacteria 876
10 Ga0070694_100651963 3300005444 Bacteria 852
11 Ga0070663_100496336 3300005455 Bacteria 1013
12 Ga0070663_100741786 3300005455 Bacteria 838
13 Ga0070678_101369511 3300005456 Bacteria 660
14 Ga0070678_101753641 3300005456 Bacteria 585
15 Ga0070684_101747394 3300005535 Bacteria 587
16 Ga0070665_100891952 3300005548 Bacteria 902
17 Ga0081538_10031972 3300005981 Bacteria 3538
18 Ga0081539_10007251 3300005985 Bacteria 10188
19 Ga0075368_10090770 3300006042 Bacteria 1249
20 Ga0075368_10102907 3300006042 Bacteria 1174
21 Ga0075364_10020050 3300006051 Bacteria 4204
22 Ga0075367_10020116 3300006178 Bacteria 3712
23 Ga0075367_10347294 3300006178 Bacteria 936
24 Ga0075428_100024308 3300006844 Bacteria 6703
25 Ga0075430_100036379 3300006846 Bacteria 4175
26 Ga0075430_100417736 3300006846 Bacteria 1107
27 Ga0075431_100213313 3300006847 Bacteria 1971
28 Ga0075434_101038540 3300006871 Bacteria 833
29 Ga0075429_100047909 3300006880 Bacteria 3717
30 Ga0068865_100514655 3300006881 Bacteria 1000
31 Ga0114129_10007463 3300009147 Bacteria 15576
32 Ga0114129_10677724 3300009147 Bacteria 1328
33 Ga0105248_13251759 3300009177 Bacteria 517
34 Ga0105238_10141261 3300009551 Bacteria 2385
35 Ga0157369_10381214 3300013105 Bacteria 1463
36 Ga0163162_12423868 3300013306 Bacteria 603
37 Ga0157375_10390182 3300013308 Bacteria 1559
38 Ga0163161_10346505 3300017792 Bacteria 1180
39 Ga0213874_10126361 3300021377 Bacteria 874
40 Ga0213876_10004486 3300021384 Bacteria 7802
41 Ga0213876_10007033 3300021384 Bacteria 6134
42 Ga0213875_10213931 3300021388 Bacteria 908
43 Ga0224572_1004205 3300024225 Bacteria 2489
44 Ga0207687_11160731 3300025927 Bacteria 664
45 Ga0207644_11083312 3300025931 Bacteria 673
46 Ga0207704_10452668 3300025938 Bacteria 1025
47 Ga0207678_10334017 3300026067 Bacteria 1305
48 Ga0207678_10786844 3300026067 Bacteria 839
49 Ga0209813_10002061 3300027866 Bacteria 4567
50 Ga0209813_10250140 3300027866 Bacteria 673
51 Ga0307511_10104286 3300030521 Bacteria 1842
52 Ga0307512_10169133 3300030522 Bacteria 1258
53 Ga0307513_10002258 3300031456 Bacteria 26916
54 Ga0307513_10576862 3300031456 Bacteria 835
55 Ga0307508_10075100 3300031616 Bacteria 2958
56 Ga0307405_10540892 3300031731 Bacteria 941
57 Ga0307413_10246279 3300031824 Bacteria 1323
58 Ga0307410_11072595 3300031852 Bacteria 697
59 Ga0307406_10232783 3300031901 Bacteria 1377
60 Ga0307406_11206376 3300031901 Bacteria 657
61 Ga0307407_10618879 3300031903 Bacteria 808
62 Ga0307409_100221601 3300031995 Bacteria 1708
63 Ga0307409_102117501 3300031995 Bacteria 592
64 Ga0307414_12265052 3300032004 Bacteria 507
65 Ga0307411_11713467 3300032005 Bacteria 582
66 Ga0307507_10000002 3300033179 Bacteria 388650
67 Ga0436365_0851018 3300039437 Bacteria 4907
68 Ga0436365_0974809 3300039437 Bacteria 643
69 Ga0436365_1449884 3300039437 Bacteria 10632
70 Ga0436365_1914036 3300039437 Bacteria 4428
71 Ga0436363_0998025 3300039450 Bacteria 1279
72 Ga0451791_0136453 3300041451 Bacteria 791
73 Ga0451853_0051447 3300041512 Bacteria 536
74 Ga0466963_0296164 3300044694 Bacteria 1138
75 Ga0466960_0139314 3300044901 Bacteria 1287
76 Ga0495592_0022990 3300046454 Bacteria 4744
77 Ga0495629_0960891 3300046459 Bacteria 558
78 Ga0495651_0005180 3300046462 Bacteria 9945
79 Ga0495653_0005527 3300046463 Bacteria 10300
80 Ga0495582_0655154 3300046473 Bacteria 608
81 Ga0495639_0378739 3300046475 Bacteria 713
82 Ga0495664_0001349 3300046477 Bacteria 12925
83 Ga0495608_0001897 3300046511 Bacteria 14972
84 Ga0495618_0108351 3300046514 Bacteria 1779
85 Ga0495628_0048694 3300046516 Bacteria 3358
86 Ga0495666_0005508 3300046526 Bacteria 6375
87 Ga0495652_0125596 3300046529 Bacteria 2038
88 Ga0495665_0007729 3300046531 Bacteria 5817
89 Ga0495640_0063821 3300046533 Bacteria 2493
90 Ga0495586_0019691 3300046535 Bacteria 3594
91 Ga0495645_0005896 3300046543 Bacteria 8460
92 Ga0495667_0057084 3300046559 Bacteria 2566
93 Ga0495634_0082124 3300046642 Bacteria 2106
94 Ga0495611_0062877 3300046648 Bacteria 1688
95 Ga0495657_0004988 3300046675 Bacteria 10549
96 Ga0495623_0020868 3300046679 Bacteria 4233
97 Ga0495613_0004146 3300046689 Bacteria 10847
98 Ga0495589_0063325 3300046794 Bacteria 1814
99 Ga0495600_0013211 3300046809 Bacteria 5183
100 Ga0495581_0016568 3300047315 Bacteria 4283
101 Ga0495604_0001127 3300047317 Bacteria 22177
102 Ga0495636_0016971 3300047318 Bacteria 2911
103 Ga0495674_0044431 3300047319 Bacteria 3950
104 Ga0495675_0033488 3300047444 Bacteria 3279
105 Ga0495684_0036204 3300047471 Bacteria 3784
106 Ga0495593_0097370 3300047673 Bacteria 1511
107 Ga0495602_0042032 3300048088 Bacteria 4167
108 Ga0496102_0299078 3300048905 Bacteria 1517
109 Ga0496102_1037129 3300048905 Bacteria 740
110 Ga0496104_1405780 3300048907 Bacteria 601
111 Ga0496109_0355247 3300048912 Bacteria 1384
112 Ga0496109_1718812 3300048912 Bacteria 561
113 Ga0496111_0269301 3300048914 Bacteria 1264
114 Ga0496112_0201233 3300048915 Bacteria 1951
115 Ga0496113_0607979 3300048916 Bacteria 875
116 Ga0496120_0164795 3300048923 Bacteria 1101
117 Ga0501036_1348483 3300049572 Bacteria 579
118 Ga0501041_0138369 3300049577 Bacteria 1518
119 Ga0501208_122401 3300049655 Bacteria 575
120 nmdc:mga00v17_124867_c1 3300050491 Bacteria 1641
121 nmdc:mga00v17_25276_c1 3300050491 Bacteria 3451
122 nmdc:mga0yw44_988711_c1 3300050492 Bacteria 570
123 nmdc:mga06z11_370020_c1 3300050494 Bacteria 860
124 nmdc:mga06z11_891673_c1 3300050494 Bacteria 542
125 nmdc:mga04h51_282118_c1 3300050495 Bacteria 673
126 nmdc:mga04h51_5127_c1 3300050495 Bacteria 3320
127 nmdc:mga05p37_5688_c1 3300050507 Bacteria 14654
128 nmdc:mga09592_121314_c1 3300050508 Bacteria 2246
129 nmdc:mga0qj67_15811_c1 3300050509 Bacteria 5716
130 nmdc:mga0qj67_3536_c1 3300050509 Bacteria 11285
131 nmdc:mga06r32_25054_c1 3300050510 Bacteria 5544
132 nmdc:mga06r32_274306_c1 3300050510 Bacteria 1674
133 nmdc:mga06r32_30494_c1 3300050510 Bacteria 5060
134 nmdc:mga0n895_1226385_c1 3300050512 Bacteria 723
135 Ga0495601_0038487 3300053077 Bacteria 2992
136 Ga0495619_0035331 3300053085 Bacteria 3250
137 Ga0500641_0092442 3300053096 Bacteria 1292
138 Ga0500573_0030563 3300053140 Bacteria 3107
139 Ga0500573_0116334 3300053140 Bacteria 1492
140 Ga0500577_0469835 3300053142 Bacteria 549
141 2644505692 2643221690 Bacteria 4654705
142 2676488974 2675903060 Bacteria 10051191
143 2753036142 2751185725 Bacteria 5740550
144 2753324014 2751185792 Bacteria 5739090
145 2884698581 2884693830 Bacteria 11273186
146 2895451178 2895442618 Bacteria 11027144
147 2909077394 2909074476 Bacteria 3436050
148 2917739902 2917736166 Bacteria 9690793
149 2919059407 2919059106 Bacteria 4991624
150 Ga0075365_10009547
151 JGI25406J46586_10006223
152 JGI25407J50210_10108548
153 Ga0070683_102189407
154 Ga0070677_10292872
155 Ga0070692_10762546
156 Ga0070671_100643053
157 Ga0070673_100492910
158 Ga0070714_100867116
159 Ga0070694_100651963
160 Ga0070663_100496336
161 Ga0070663_100741786
162 Ga0070678_101369511
163 Ga0070678_101753641
164 Ga0070684_101747394
165 Ga0070665_100891952
166 Ga0081538_10031972
167 Ga0081539_10007251
168 Ga0075368_10090770
169 Ga0075368_10102907
170 Ga0075364_10020050
171 Ga0075367_10020116
172 Ga0075367_10347294
173 Ga0075428_100024308
174 Ga0075430_100036379
175 Ga0075430_100417736
176 Ga0075431_100213313
177 Ga0075434_101038540
178 Ga0075429_100047909
179 Ga0068865_100514655
180 Ga0114129_10007463
181 Ga0114129_10677724
182 Ga0105248_13251759
183 Ga0105238_10141261
184 Ga0157369_10381214
185 Ga0163162_12423868
186 Ga0157375_10390182
187 Ga0163161_10346505
188 Ga0213874_10126361
189 Ga0213876_10004486
190 Ga0213876_10007033
191 Ga0213875_10213931
192 Ga0224572_1004205
193 Ga0207687_11160731
194 Ga0207644_11083312
195 Ga0207704_10452668
196 Ga0207678_10334017
197 Ga0207678_10786844
198 Ga0209813_10002061
199 Ga0209813_10250140
200 Ga0307511_10104286
201 Ga0307512_10169133
202 Ga0307513_10002258
203 Ga0307513_10576862
204 Ga0307508_10075100
205 Ga0307405_10540892
206 Ga0307413_10246279
207 Ga0307410_11072595
208 Ga0307406_10232783
209 Ga0307406_11206376
210 Ga0307407_10618879
211 Ga0307409_100221601
212 Ga0307409_102117501
213 Ga0307414_12265052
214 Ga0307411_11713467
215 Ga0307507_10000002
216 Ga0436365_0851018
217 Ga0436365_0974809
218 Ga0436365_1449884
219 Ga0436365_1914036
220 Ga0436363_0998025
221 Ga0451791_0136453
222 Ga0451853_0051447
223 Ga0466963_0296164
224 Ga0466960_0139314
225 Ga0495592_0022990
226 Ga0495629_0960891
227 Ga0495651_0005180
228 Ga0495653_0005527
229 Ga0495582_0655154
230 Ga0495639_0378739
231 Ga0495664_0001349
232 Ga0495608_0001897
233 Ga0495618_0108351
234 Ga0495628_0048694
235 Ga0495666_0005508
236 Ga0495652_0125596
237 Ga0495665_0007729
238 Ga0495640_0063821
239 Ga0495586_0019691
240 Ga0495645_0005896
241 Ga0495667_0057084
242 Ga0495634_0082124
243 Ga0495611_0062877
244 Ga0495657_0004988
245 Ga0495623_0020868
246 Ga0495613_0004146
247 Ga0495589_0063325
248 Ga0495600_0013211
249 Ga0495581_0016568
250 Ga0495604_0001127
251 Ga0495636_0016971
252 Ga0495674_0044431
253 Ga0495675_0033488
254 Ga0495684_0036204
255 Ga0495593_0097370
256 Ga0495602_0042032
257 Ga0496102_0299078
258 Ga0496102_1037129
259 Ga0496104_1405780
260 Ga0496109_0355247
261 Ga0496109_1718812
262 Ga0496111_0269301
263 Ga0496112_0201233
264 Ga0496113_0607979
265 Ga0496120_0164795
266 Ga0501036_1348483
267 Ga0501041_0138369
268 Ga0501208_122401
269 nmdc:mga00v17_124867_c1
270 nmdc:mga00v17_25276_c1
271 nmdc:mga0yw44_988711_c1
272 nmdc:mga06z11_370020_c1
273 nmdc:mga06z11_891673_c1
274 nmdc:mga04h51_282118_c1
275 nmdc:mga04h51_5127_c1
276 nmdc:mga05p37_5688_c1
277 nmdc:mga09592_121314_c1
278 nmdc:mga0qj67_15811_c1
279 nmdc:mga0qj67_3536_c1
280 nmdc:mga06r32_25054_c1
281 nmdc:mga06r32_274306_c1
282 nmdc:mga06r32_30494_c1
283 nmdc:mga0n895_1226385_c1
284 Ga0495601_0038487
285 Ga0495619_0035331
286 Ga0500641_0092442
287 Ga0500573_0030563
288 Ga0500573_0116334
289 Ga0500577_0469835
290 2644505692
291 2676488974
292 2753036142
293 2753324014
294 2884698581
295 2895451178
296 2909077394
297 2917739902
298 2919059407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

18

127

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.795 1 124
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.7867 1 124
4nb1-assembly1.cif.gz_B crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.7647 1 124
4naz-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with zn and sulfate at 1.15 angstrom resolution 0.7621 1 124
1lqo-assembly1.cif.gz_B crystal strutcure of the fosfomycin resistance protein a (fosa) containing bound thallium cations 0.7611 1 120
ID Description Score Start End Superfamily
af_O06633_2_115_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8073 2 122 3.10.180.10
af_O06633_2_115_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8009 2 122 3.10.180.10
3vcxB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7826 9 58 3.30.720.120
af_Q2FYM3_1_61_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7701 3 64 3.10.180.10
4nazA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7621 1 124 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A1M4EF11-F1-model_v4 VOC domain-containing protein 0.9591 1 125
AF-A0A653Y3T1-F1-model_v4 Enzyme related to lactoylglutathione lyase (Modular protein) 0.9524 1 126 GO:0016829
AF-A0A1M4EF11-F1-model_v4 VOC domain-containing protein 0.9517 1 125
AF-D9WPR2-F1-model_v4 VOC domain-containing protein 0.9505 1 127
AF-A0A327T8F6-F1-model_v4 deleted 0.9467 1 120

Map