F205360

General Info

Members Datasets Scaffolds Average Seq Length
149 115 131 119

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_101575996|Ga0070678_1015759962
Length 127
Sequence MTATAGLLVVLGAAVGAPARYLTDRWLQSTHGNGFPWGTFTVNIAASLVLGVITGLAAVAAVSPAIAVLIGTGFCGALSTWSTLGYETVRLAEDRAWTQAVFNIVASVLAGLGAAGLGFAIAAGVTG

Samples

Sample ID Description Type Environment
1 2517572101 Frankia sp. DC12 Isolate Nodule
2 2527291627 Frankia casuarinae Thr Isolate Nodule
3 2527291629 Frankia sp. BMG5.23 Isolate Nodule
4 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
5 2576861822 Frankia sp. CeD Isolate Nodule
6 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
7 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
8 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
9 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
10 2684623036 Frankia sp. CgIM4 Isolate Nodule
11 2710264753 Frankia sp. KB5 Isolate Nodule
12 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
13 2773857924 Frankia sp. CgIS1 Isolate Nodule
14 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
15 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
57 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
58 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
59 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
60 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
61 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
62 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
63 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
68 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
69 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
70 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
75 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
76 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
77 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
78 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
79 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
80 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
81 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
82 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
83 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
84 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
85 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
86 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
87 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
88 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
93 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
94 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
95 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
96 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
101 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
102 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
103 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
104 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
105 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
112 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
113 637000116 Frankia casuarinae CcI3 Isolate Nodule
114 8002784119 Frankia sp. AgB1.9 Isolate Nodule
115 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.25
Metatranscriptomes 0.67
Isolates 12.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.34
Nodule 6.04
Rhizoplane 4.7
Rhizosphere 81.21
Stem 0
Stem Tuber 0
Unclassified 6.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10609806 3300005327 Bacteria 946
2 Ga0070658_10876734 3300005327 Bacteria 780
3 Ga0068869_100357903 3300005334 Bacteria 1191
4 Ga0070682_100064485 3300005337 Bacteria 2325
5 Ga0070668_100843623 3300005347 Bacteria 816
6 Ga0070675_100950541 3300005354 Bacteria 788
7 Ga0070674_100245662 3300005356 Bacteria 1403
8 Ga0070714_100000007 3300005435 Bacteria 285654
9 Ga0070714_101210473 3300005435 Bacteria 737
10 Ga0070700_101003785 3300005441 Bacteria 686
11 Ga0070678_101575996 3300005456 Bacteria 616
12 Ga0070684_101055157 3300005535 Bacteria 763
13 Ga0070665_100934174 3300005548 Bacteria 880
14 Ga0070664_101751064 3300005564 Bacteria 589
15 Ga0068854_100389851 3300005578 Bacteria 1150
16 Ga0068859_100001814 3300005617 Bacteria 21752
17 Ga0068861_101611477 3300005719 Bacteria 640
18 Ga0068858_100855159 3300005842 Bacteria 888
19 Ga0075430_100283826 3300006846 Bacteria 1370
20 Ga0068865_100477124 3300006881 Bacteria 1036
21 Ga0097620_100001814 3300006931 Bacteria 21752
22 Ga0105251_10182190 3300009011 Bacteria 946
23 Ga0105240_11057642 3300009093 Bacteria 865
24 Ga0105245_10012831 3300009098 Bacteria 7300
25 Ga0105247_10007531 3300009101 Bacteria 6672
26 Ga0105237_11526428 3300009545 Bacteria 675
27 Ga0157379_10197389 3300014968 Bacteria 1819
28 Ga0206353_11669576 3300020082 Bacteria 717
29 Ga0213876_10515890 3300021384 Bacteria 636
30 Ga0207713_1120290 3300025735 Bacteria 881
31 Ga0207710_10032270 3300025900 Bacteria 2293
32 Ga0207705_10448483 3300025909 Bacteria 1000
33 Ga0207695_10319356 3300025913 Bacteria 1443
34 Ga0207687_10008481 3300025927 Bacteria 6718
35 Ga0207664_10000014 3300025929 Bacteria 249865
36 Ga0207664_11500397 3300025929 Bacteria 596
37 Ga0207706_10383020 3300025933 Bacteria 1220
38 Ga0207669_10599709 3300025937 Bacteria 895
39 Ga0207679_10748698 3300025945 Bacteria 889
40 Ga0207668_10384016 3300025972 Bacteria 1183
41 Ga0207640_10135516 3300025981 Bacteria 1787
42 Ga0207675_101785979 3300026118 Bacteria 634
43 Ga0268266_11081573 3300028379 Bacteria 776
44 Ga0316176_1007144 3300030732 Bacteria 503
45 Ga0316181_1210317 3300030744 Bacteria 1100
46 Ga0307408_100023396 3300031548 Bacteria 4208
47 Ga0307408_101178068 3300031548 Bacteria 714
48 Ga0316575_10000002 3300031665 Bacteria 148142
49 Ga0307405_10142427 3300031731 Bacteria 1674
50 Ga0307413_10097419 3300031824 Bacteria 1934
51 Ga0307413_11212027 3300031824 Bacteria 657
52 Ga0307410_10134889 3300031852 Bacteria 1818
53 Ga0307410_10315824 3300031852 Bacteria 1238
54 Ga0307407_10007319 3300031903 Bacteria 4991
55 Ga0307407_10618710 3300031903 Bacteria 808
56 Ga0307412_10340917 3300031911 Bacteria 1200
57 Ga0307409_100028195 3300031995 Bacteria 3995
58 Ga0307409_100067753 3300031995 Bacteria 2820
59 Ga0307409_100575754 3300031995 Bacteria 1109
60 Ga0307409_100809625 3300031995 Bacteria 945
61 Ga0307409_101569846 3300031995 Bacteria 686
62 Ga0307416_100569397 3300032002 Bacteria 1208
63 Ga0307414_10119825 3300032004 Bacteria 2021
64 Ga0307411_10122894 3300032005 Bacteria 1882
65 Ga0307415_101902955 3300032126 Bacteria 577
66 Ga0373953_0378684 3300035117 Bacteria 622
67 Ga0395900_0170336 3300037418 Bacteria 2217
68 Ga0395898_0087338 3300037466 Bacteria 3004
69 Ga0395901_0079305 3300038443 Bacteria 3428
70 Ga0436365_1612993 3300039437 Bacteria 1339
71 Ga0439438_074756 3300041405 Bacteria 836
72 Ga0439438_095222 3300041405 Bacteria 724
73 Ga0439438_165793 3300041405 Bacteria 526
74 Ga0439439_0004592 3300041406 Bacteria 3123
75 Ga0439466_0097790 3300041411 Bacteria 917
76 Ga0439442_082885 3300042002 Bacteria 687
77 Ga0439449_0036342 3300042007 Bacteria 1832
78 Ga0439449_0056534 3300042007 Bacteria 1449
79 Ga0439457_001554 3300042014 Bacteria 6880
80 Ga0466966_0177012 3300044684 Bacteria 1295
81 Ga0466961_0074664 3300044693 Bacteria 2150
82 Ga0466961_0912394 3300044693 Bacteria 523
83 Ga0466963_0012077 3300044694 Bacteria 5277
84 Ga0466963_0019327 3300044694 Bacteria 4270
85 Ga0466963_0198272 3300044694 Bacteria 1404
86 Ga0466963_0775685 3300044694 Bacteria 676
87 Ga0466964_0253878 3300044706 Bacteria 868
88 Ga0466957_0014249 3300044842 Bacteria 4628
89 Ga0466957_0092822 3300044842 Bacteria 1894
90 Ga0466957_0456549 3300044842 Bacteria 881
91 Ga0466960_0024542 3300044901 Bacteria 2721
92 Ga0466960_0025438 3300044901 Bacteria 2679
93 Ga0466960_0388890 3300044901 Bacteria 801
94 Ga0466960_0491902 3300044901 Bacteria 718
95 Ga0466960_0724789 3300044901 Bacteria 598
96 Ga0466960_0729265 3300044901 Bacteria 596
97 Ga0466960_0934618 3300044901 Bacteria 530
98 Ga0466959_0113090 3300045049 Bacteria 1936
99 Ga0466958_0021123 3300045836 Bacteria 3801
100 Ga0466967_0086208 3300045976 Bacteria 2845
101 Ga0466967_0099273 3300045976 Bacteria 2659
102 Ga0466967_0171195 3300045976 Bacteria 2043
103 Ga0466967_0194178 3300045976 Bacteria 1920
104 Ga0466967_0306071 3300045976 Bacteria 1530
105 Ga0466967_0374616 3300045976 Bacteria 1381
106 Ga0466967_0991881 3300045976 Bacteria 836
107 Ga0466967_1024959 3300045976 Bacteria 822
108 Ga0495584_0184570 3300046491 Bacteria 1060
109 Ga0495608_0503881 3300046511 Bacteria 733
110 Ga0495663_0340413 3300046525 Bacteria 545
111 Ga0495609_0396478 3300046538 Bacteria 553
112 Ga0495621_0409726 3300046539 Bacteria 576
113 Ga0495634_0500979 3300046642 Bacteria 712
114 Ga0495661_0203334 3300046665 Bacteria 1036
115 Ga0496102_0000013 3300048905 Bacteria 311668
116 Ga0496102_0038049 3300048905 Bacteria 4340
117 Ga0496103_0077767 3300048906 Bacteria 2083
118 Ga0496109_0407385 3300048912 Bacteria 1285
119 Ga0496111_0226989 3300048914 Bacteria 1387
120 Ga0496113_0328388 3300048916 Bacteria 1226
121 Ga0496117_0516492 3300048920 Bacteria 576
122 Ga0496118_0016079 3300048921 Bacteria 6885
123 Ga0496119_0016354 3300048922 Bacteria 5650
124 Ga0496121_0007704 3300048924 Bacteria 12924
125 Ga0496126_0000013 3300048929 Bacteria 690046
126 Ga0501037_0307846 3300049573 Bacteria 1099
127 Ga0501047_0000083 3300049581 Bacteria 121172
128 Ga0501074_0932083 3300049590 Bacteria 611
129 Ga0501044_0125623 3300049823 Bacteria 2563
130 Ga0500568_0001480 3300053139 Bacteria 15054
131 Ga0500587_059223 3300053739 Bacteria 583

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028379 Ga0268266_11081573 Ga0268266_110815731 101
2 3300031903 Ga0307407_10618710 Ga0307407_106187101 104
3 3300005334 Ga0068869_100357903 Ga0068869_1003579032 105
4 3300009011 Ga0105251_10182190 Ga0105251_101821902 105
5 3300025735 Ga0207713_1120290 Ga0207713_11202902 105
6 3300037418 Ga0395900_0170336 Ga0395900_0170336_1162_1533 105
7 3300037466 Ga0395898_0087338 Ga0395898_0087338_2438_2809 105
8 3300038443 Ga0395901_0079305 Ga0395901_0079305_2765_3136 105
9 3300044901 Ga0466960_0934618 Ga0466960_0934618_79_486 105
10 3300041405 Ga0439438_074756 Ga0439438_074756_29_391 106
11 3300042007 Ga0439449_0056534 Ga0439449_0056534_95_457 106
12 3300014968 Ga0157379_10197389 Ga0157379_101973892 109
13 iso_pu_bacteria 2915358134 2915359414 109
14 3300005548 Ga0070665_100934174 Ga0070665_1009341742 110
15 3300005617 Ga0068859_100001814 Ga0068859_1000018149 110
16 3300006931 Ga0097620_100001814 Ga0097620_1000018149 110
17 3300025900 Ga0207710_10032270 Ga0207710_100322704 110
18 3300025933 Ga0207706_10383020 Ga0207706_103830202 110
19 3300005435 Ga0070714_101210473 Ga0070714_1012104732 111
20 3300025929 Ga0207664_11500397 Ga0207664_115003971 111
21 3300031995 Ga0307409_100067753 Ga0307409_1000677533 111
22 3300041405 Ga0439438_165793 Ga0439438_165793_60_422 111
23 3300041406 Ga0439439_0004592 Ga0439439_0004592_1421_1783 111
24 3300041411 Ga0439466_0097790 Ga0439466_0097790_482_844 111
25 3300042002 Ga0439442_082885 Ga0439442_082885_95_457 111
26 3300042007 Ga0439449_0036342 Ga0439449_0036342_882_1244 111
27 3300042014 Ga0439457_001554 Ga0439457_001554_743_1105 111
28 3300005347 Ga0070668_100843623 Ga0070668_1008436231 112
29 3300005435 Ga0070714_100000007 Ga0070714_100000007134 112
30 3300025929 Ga0207664_10000014 Ga0207664_1000001498 112
31 3300025972 Ga0207668_10384016 Ga0207668_103840162 112
32 iso_pu_bacteria 2731639228 2731906350 113
33 3300009101 Ga0105247_10007531 Ga0105247_100075314 114
34 3300044694 Ga0466963_0012077 Ga0466963_0012077_4199_4573 114
35 3300044842 Ga0466957_0014249 Ga0466957_0014249_3597_3971 114
36 3300044901 Ga0466960_0025438 Ga0466960_0025438_2277_2651 114
37 3300045836 Ga0466958_0021123 Ga0466958_0021123_3158_3532 114
38 3300045976 Ga0466967_0374616 Ga0466967_0374616_410_784 114
39 3300048905 Ga0496102_0000013 Ga0496102_0000013_282437_282790 114
40 3300048921 Ga0496118_0016079 Ga0496118_0016079_2258_2611 114
41 3300048922 Ga0496119_0016354 Ga0496119_0016354_4525_4878 114
42 iso_pu_bacteria 2622736605 2623500370 114
43 iso_pu_bacteria 2919446982 2919450091 114
44 3300031995 Ga0307409_101569846 Ga0307409_1015698461 115
45 3300044694 Ga0466963_0198272 Ga0466963_0198272_909_1259 115
46 3300044842 Ga0466957_0456549 Ga0466957_0456549_394_744 115
47 3300045976 Ga0466967_0099273 Ga0466967_0099273_1774_2124 115
48 3300046511 Ga0495608_0503881 Ga0495608_0503881_364_720 115
49 3300048929 Ga0496126_0000013 Ga0496126_0000013_658472_658825 115
50 iso_pu_bacteria 2517572101 2517762297 115
51 iso_pu_bacteria 2527291627 2528206464 115
52 iso_pu_bacteria 2527291629 2528216166 115
53 iso_pu_bacteria 2546825537 2546947999 115
54 iso_pu_bacteria 2576861822 2579751214 115
55 iso_pu_bacteria 2675903059 2676481095 115
56 iso_pu_bacteria 2684623036 2686541529 115
57 iso_pu_bacteria 2710264753 2710605876 115
58 iso_pu_bacteria 2773857924 2774864471 115
59 iso_pu_bacteria 637000116 637879653 115
60 iso_pu_bacteria 8002784119 8002784765 115
61 iso_pu_bacteria 8056054917 8056057771 115
62 3300005441 Ga0070700_101003785 Ga0070700_1010037852 116
63 3300031665 Ga0316575_10000002 Ga0316575_1000000283 116
64 3300044684 Ga0466966_0177012 Ga0466966_0177012_355_708 116
65 3300044693 Ga0466961_0074664 Ga0466961_0074664_1550_1903 116
66 3300005327 Ga0070658_10876734 Ga0070658_108767342 117
67 3300009098 Ga0105245_10012831 Ga0105245_100128315 117
68 3300025927 Ga0207687_10008481 Ga0207687_100084817 117
69 3300044842 Ga0466957_0092822 Ga0466957_0092822_491_859 117
70 3300044901 Ga0466960_0388890 Ga0466960_0388890_351_719 117
71 3300045976 Ga0466967_0171195 Ga0466967_0171195_1006_1374 117
72 3300048912 Ga0496109_0407385 Ga0496109_0407385_603_974 117
73 3300048914 Ga0496111_0226989 Ga0496111_0226989_473_844 117
74 3300048916 Ga0496113_0328388 Ga0496113_0328388_69_440 117
75 iso_pu_bacteria 2643221601 2644018403 117
76 iso_pu_bacteria 2643221631 2644177599 117
77 3300005354 Ga0070675_100950541 Ga0070675_1009505412 118
78 3300005356 Ga0070674_100245662 Ga0070674_1002456622 118
79 3300005564 Ga0070664_101751064 Ga0070664_1017510641 118
80 3300005719 Ga0068861_101611477 Ga0068861_1016114771 118
81 3300005842 Ga0068858_100855159 Ga0068858_1008551592 118
82 3300009093 Ga0105240_11057642 Ga0105240_110576422 118
83 3300009545 Ga0105237_11526428 Ga0105237_115264281 118
84 3300020082 Ga0206353_11669576 Ga0206353_116695762 118
85 3300021384 Ga0213876_10515890 Ga0213876_105158902 118
86 3300025913 Ga0207695_10319356 Ga0207695_103193562 118
87 3300025937 Ga0207669_10599709 Ga0207669_105997092 118
88 3300025945 Ga0207679_10748698 Ga0207679_107486982 118
89 3300026118 Ga0207675_101785979 Ga0207675_1017859791 118
90 3300031548 Ga0307408_100023396 Ga0307408_1000233963 118
91 3300031548 Ga0307408_101178068 Ga0307408_1011780681 118
92 3300031731 Ga0307405_10142427 Ga0307405_101424273 118
93 3300031824 Ga0307413_10097419 Ga0307413_100974192 118
94 3300031852 Ga0307410_10134889 Ga0307410_101348893 118
95 3300031852 Ga0307410_10315824 Ga0307410_103158241 118
96 3300031903 Ga0307407_10007319 Ga0307407_100073193 118
97 3300031911 Ga0307412_10340917 Ga0307412_103409172 118
98 3300031995 Ga0307409_100028195 Ga0307409_1000281955 118
99 3300031995 Ga0307409_100575754 Ga0307409_1005757543 118
100 3300031995 Ga0307409_100809625 Ga0307409_1008096252 118
101 3300032002 Ga0307416_100569397 Ga0307416_1005693972 118
102 3300032004 Ga0307414_10119825 Ga0307414_101198253 118
103 3300032005 Ga0307411_10122894 Ga0307411_101228943 118
104 3300032126 Ga0307415_101902955 Ga0307415_1019029552 118
105 3300039437 Ga0436365_1612993 Ga0436365_1612993_958_1323 118
106 3300044693 Ga0466961_0912394 Ga0466961_0912394_28_393 118
107 3300044694 Ga0466963_0019327 Ga0466963_0019327_1750_2109 118
108 3300044694 Ga0466963_0775685 Ga0466963_0775685_192_551 118
109 3300044706 Ga0466964_0253878 Ga0466964_0253878_237_602 118
110 3300044901 Ga0466960_0024542 Ga0466960_0024542_399_764 118
111 3300044901 Ga0466960_0491902 Ga0466960_0491902_79_438 118
112 3300044901 Ga0466960_0724789 Ga0466960_0724789_119_484 118
113 3300044901 Ga0466960_0729265 Ga0466960_0729265_120_485 118
114 3300045049 Ga0466959_0113090 Ga0466959_0113090_1144_1503 118
115 3300045976 Ga0466967_0086208 Ga0466967_0086208_681_1040 118
116 3300045976 Ga0466967_0194178 Ga0466967_0194178_819_1184 118
117 3300045976 Ga0466967_0306071 Ga0466967_0306071_954_1319 118
118 3300045976 Ga0466967_0991881 Ga0466967_0991881_197_556 118
119 3300045976 Ga0466967_1024959 Ga0466967_1024959_343_708 118
120 3300046491 Ga0495584_0184570 Ga0495584_0184570_663_1028 118
121 3300046525 Ga0495663_0340413 Ga0495663_0340413_60_428 118
122 3300046538 Ga0495609_0396478 Ga0495609_0396478_132_500 118
123 3300046539 Ga0495621_0409726 Ga0495621_0409726_141_509 118
124 3300046665 Ga0495661_0203334 Ga0495661_0203334_35_403 118
125 3300048905 Ga0496102_0038049 Ga0496102_0038049_211_576 118
126 3300048906 Ga0496103_0077767 Ga0496103_0077767_1238_1603 118
127 3300048920 Ga0496117_0516492 Ga0496117_0516492_90_455 118
128 3300048924 Ga0496121_0007704 Ga0496121_0007704_3011_3376 118
129 3300049573 Ga0501037_0307846 Ga0501037_0307846_629_994 118
130 3300049590 Ga0501074_0932083 Ga0501074_0932083_216_581 118
131 3300049823 Ga0501044_0125623 Ga0501044_0125623_1822_2187 118
132 3300053139 Ga0500568_0001480 Ga0500568_0001480_1769_2146 118
133 3300053739 Ga0500587_059223 Ga0500587_059223_70_438 118
134 3300005327 Ga0070658_10609806 Ga0070658_106098062 119
135 3300005337 Ga0070682_100064485 Ga0070682_1000644851 119
136 3300005456 Ga0070678_101575996 Ga0070678_1015759962 119
137 3300005535 Ga0070684_101055157 Ga0070684_1010551571 119
138 3300005578 Ga0068854_100389851 Ga0068854_1003898511 119
139 3300006846 Ga0075430_100283826 Ga0075430_1002838262 119
140 3300006881 Ga0068865_100477124 Ga0068865_1004771242 119
141 3300025909 Ga0207705_10448483 Ga0207705_104484832 119
142 3300025981 Ga0207640_10135516 Ga0207640_101355161 119
143 3300030732 Ga0316176_1007144 Ga0316176_10071441 119
144 3300030744 Ga0316181_1210317 Ga0316181_12103173 119
145 3300031824 Ga0307413_11212027 Ga0307413_112120271 119
146 3300035117 Ga0373953_0378684 Ga0373953_0378684_88_456 119
147 3300041405 Ga0439438_095222 Ga0439438_095222_34_396 119
148 3300046642 Ga0495634_0500979 Ga0495634_0500979_324_692 119
149 3300049581 Ga0501047_0000083 Ga0501047_0000083_84478_84852 119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02537

CRCB

CrcB-like protein, Camphor Resistance (CrcB)

7

119

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b2b-assembly1.cif.gz_B crystal structure of fluoride channel fluc ec2 f83m mutant 0.7935 2 117
7kk8-assembly1.cif.gz_B fluoride channel fluc-ec2 mutant s81t with bromide 0.7896 2 117
7kka-assembly1.cif.gz_B fluoride channel fluc-ec2 mutant s81a with bromide 0.7888 2 117
5kom-assembly1.cif.gz_A the crystal structure of fluoride channel fluc ec2 f83i mutant 0.788 2 117
6b2a-assembly1.cif.gz_B crystal structure of fluoride channel fluc ec2 f80m mutant 0.7878 2 117
ID Description Score Start End Superfamily
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8257 5 110 1.10.287.70
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7993 5 110 1.10.287.70
af_P37002_6_119_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7985 5 111 1.10.287.70
af_B6SKI7_170_306_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7831 2 117 1.10.287.70
af_Q4D2Y9_236_346_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7754 1 111 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A2A2XUC8-F1-model_v4 Fluoride-specific ion channel FluC 0.8967 2 117 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A6V7RKI7-F1-model_v4 Fluoride-specific ion channel FluC 0.8856 2 114 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A7G9S7M4-F1-model_v4 Fluoride-specific ion channel FluC 0.8838 2 114 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A086BP59-F1-model_v4 Fluoride-specific ion channel FluC 0.8834 2 113 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A358JWB1-F1-model_v4 Fluoride-specific ion channel FluC 0.8704 2 117 GO:0005886
GO:0046872
GO:0062054
GO:0140114

Feature Viewer

pLDDT pTM Quality
87.6 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map