F205335

General Info

Members Datasets Scaffolds Average Seq Length
149 114 298 156

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100084676|Ga0070708_1000846762
Length 184
Sequence LSVSQSGASGLTVWIGCLGPNFERQIEIMSCVCILTPVVIAAWPAFSAAVMAAASSLGYALVEETKKMAADADKPARVNRVDLEVPHSELVTDTLSRDQRISVTRDGVTVSFARDARGKASLCVTGEGHSEAELRARGEELSQRLVQKYVYQRLMQEMRSRQFVVVEEEIQSQAIRLKVRHWEN

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
56 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
57 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
58 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
59 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
62 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
63 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
64 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
65 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
70 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
71 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
72 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
73 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
83 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
84 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
85 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
86 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
87 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
88 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
89 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
90 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
91 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
92 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
93 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
94 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
95 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
98 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
113 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
114 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 1.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 0
Rhizosphere 96.64
Stem 0
Stem Tuber 0
Unclassified 45.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100084676 3300005445 Bacteria 2876
2 rootH2_10254140 3300003320 Unclassified 1278
3 rootL2_10240261 3300003322 Unclassified 1505
4 Ga0058859_10024264 3300004798 Unclassified 712
5 Ga0058860_12032570 3300004801 Unclassified 763
6 Ga0070690_100124529 3300005330 Bacteria 1734
7 Ga0070690_100501125 3300005330 Bacteria 908
8 Ga0070677_10042299 3300005333 Bacteria 1803
9 Ga0068869_101084852 3300005334 Unclassified 700
10 Ga0070666_10151424 3300005335 Bacteria 1618
11 Ga0070660_100124969 3300005339 Unclassified 2055
12 Ga0070689_100575491 3300005340 Unclassified 973
13 Ga0070689_101121704 3300005340 Unclassified 704
14 Ga0070689_101642271 3300005340 Unclassified 584
15 Ga0070691_10175929 3300005341 Unclassified 1111
16 Ga0070675_101067566 3300005354 Unclassified 742
17 Ga0070688_100292273 3300005365 Bacteria 1175
18 Ga0070700_100799123 3300005441 Unclassified 759
19 Ga0070694_100153003 3300005444 Bacteria 1686
20 Ga0070681_10246575 3300005458 Bacteria 1699
21 Ga0070679_100270312 3300005530 Unclassified 1654
22 Ga0070684_100175376 3300005535 Bacteria 1948
23 Ga0070684_100615525 3300005535 Bacteria 1010
24 Ga0070704_101348599 3300005549 Bacteria 653
25 Ga0068855_100171285 3300005563 Bacteria 2459
26 Ga0068857_100308638 3300005577 Unclassified 1459
27 Ga0068856_101453427 3300005614 Unclassified 700
28 Ga0068859_100063230 3300005617 Bacteria 3732
29 Ga0068859_100369702 3300005617 Bacteria 1529
30 Ga0068861_100216169 3300005719 Bacteria 1617
31 Ga0068863_100010044 3300005841 Bacteria 9214
32 Ga0068858_100063174 3300005842 Bacteria 3426
33 Ga0075430_100352205 3300006846 Bacteria 1216
34 Ga0097620_100063229 3300006931 Bacteria 3732
35 Ga0097620_100369681 3300006931 Bacteria 1529
36 Ga0099794_10415379 3300007265 Unclassified 703
37 Ga0105240_10028396 3300009093 Bacteria 7309
38 Ga0111539_10072364 3300009094 Bacteria 4065
39 Ga0105238_10938957 3300009551 Unclassified 884
40 Ga0157370_10074368 3300013104 Bacteria 3205
41 Ga0157369_10692289 3300013105 Bacteria 1050
42 Ga0157378_10557149 3300013297 Unclassified 1152
43 Ga0157372_10486785 3300013307 Unclassified 1438
44 Ga0157372_12183200 3300013307 Bacteria 636
45 Ga0157375_10773105 3300013308 Bacteria 1110
46 Ga0163163_10000126 3300014325 Bacteria 79511
47 Ga0163163_10103424 3300014325 Unclassified 2873
48 Ga0157380_12274964 3300014326 Bacteria 606
49 Ga0207680_10163481 3300025903 Bacteria 1495
50 Ga0207705_10113014 3300025909 Bacteria 2008
51 Ga0207695_10474154 3300025913 Bacteria 1134
52 Ga0207693_10434727 3300025915 Unclassified 1026
53 Ga0207652_10641804 3300025921 Unclassified 950
54 Ga0207670_10658114 3300025936 Unclassified 864
55 Ga0207670_10971805 3300025936 Unclassified 714
56 Ga0207661_10207833 3300025944 Unclassified 1724
57 Ga0207667_10917974 3300025949 Unclassified 867
58 Ga0207703_10040370 3300026035 Bacteria 3734
59 Ga0207708_10192385 3300026075 Bacteria 1624
60 Ga0207641_10009532 3300026088 Bacteria 8001
61 Ga0207674_10673487 3300026116 Bacteria 999
62 Ga0207675_100607811 3300026118 Bacteria 1097
63 Ga0207675_101481038 3300026118 Unclassified 699
64 Ga0268265_10929438 3300028380 Unclassified 856
65 Ga0265337_1002437 3300028556 Bacteria 8543
66 Ga0265326_10144221 3300028558 Unclassified 680
67 Ga0265319_1013277 3300028563 Unclassified 3286
68 Ga0265322_10145881 3300028654 Unclassified 676
69 Ga0265336_10004207 3300028666 Bacteria 5474
70 Ga0265338_10000208 3300028800 Bacteria 109817
71 Ga0265338_10002629 3300028800 Bacteria 26496
72 Ga0265338_10011590 3300028800 Bacteria 10164
73 Ga0265338_10012183 3300028800 Bacteria 9822
74 Ga0265338_10016394 3300028800 Bacteria 8067
75 Ga0265338_10022950 3300028800 Bacteria 6436
76 Ga0265338_10034147 3300028800 Unclassified 4921
77 Ga0265338_10043600 3300028800 Unclassified 4158
78 Ga0265338_10222574 3300028800 Unclassified 1409
79 Ga0265338_10297640 3300028800 Unclassified 1174
80 Ga0265338_10538081 3300028800 Unclassified 819
81 Ga0265324_10240558 3300029957 Unclassified 615
82 Ga0265328_10122669 3300031239 Bacteria 970
83 Ga0265320_10016477 3300031240 Bacteria 4139
84 Ga0265320_10036079 3300031240 Unclassified 2501
85 Ga0265340_10082411 3300031247 Unclassified 1513
86 Ga0265340_10115613 3300031247 Unclassified 1237
87 Ga0265327_10013775 3300031251 Bacteria 5343
88 Ga0265316_10764595 3300031344 Unclassified 679
89 Ga0265313_10221505 3300031595 Bacteria 780
90 Ga0307416_101913200 3300032002 Unclassified 696
91 Ga0373954_0007008 3300035118 Bacteria 4918
92 Ga0373956_0041233 3300035119 Unclassified 2049
93 Ga0373955_0109989 3300035172 Unclassified 1592
94 Ga0373933_0021200 3300035724 Unclassified 3689
95 Ga0373947_0100063 3300035725 Bacteria 1821
96 Ga0373937_0015756 3300036401 Bacteria 6696
97 Ga0373925_0164378 3300037068 Bacteria 1750
98 Ga0451577_0265555 3300042876 Unclassified 1554
99 Ga0451577_1317911 3300042876 Unclassified 642
100 Ga0453683_0255701 3300044673 Bacteria 1117
101 Ga0453684_0007853 3300044712 Bacteria 19420
102 Ga0453684_0154478 3300044712 Bacteria 2723
103 Ga0451576_0276992 3300045051 Bacteria 1754
104 Ga0451576_0312270 3300045051 Bacteria 1645
105 Ga0451576_0328625 3300045051 Bacteria 1600
106 Ga0451576_1084530 3300045051 Bacteria 838
107 Ga0495592_0402042 3300046454 Unclassified 867
108 Ga0495629_0106474 3300046459 Unclassified 1956
109 Ga0495641_0074796 3300046461 Bacteria 1519
110 Ga0495582_0009809 3300046473 Bacteria 5275
111 Ga0495639_0366019 3300046475 Unclassified 725
112 Ga0495662_0170173 3300046476 Unclassified 1073
113 Ga0495618_0000552 3300046514 Bacteria 26567
114 Ga0495628_0639710 3300046516 Bacteria 756
115 Ga0495630_0003088 3300046517 Bacteria 11555
116 Ga0495630_0064373 3300046517 Unclassified 2755
117 Ga0495630_0210820 3300046517 Unclassified 1483
118 Ga0495630_0719854 3300046517 Unclassified 763
119 Ga0495630_0900990 3300046517 Bacteria 674
120 Ga0495666_0003511 3300046526 Bacteria 7911
121 Ga0495665_0056762 3300046531 Bacteria 2067
122 Ga0495586_0001822 3300046535 Bacteria 11633
123 Ga0495586_0010887 3300046535 Bacteria 4832
124 Ga0495598_0327095 3300046537 Unclassified 585
125 Ga0495634_0000669 3300046642 Bacteria 33295
126 Ga0495634_0015455 3300046642 Bacteria 5485
127 Ga0495647_0145421 3300046681 Unclassified 1013
128 Ga0495658_0010588 3300046683 Bacteria 4615
129 Ga0495613_0017561 3300046689 Bacteria 5328
130 Ga0495613_0022908 3300046689 Unclassified 4654
131 Ga0495674_0004712 3300047319 Bacteria 13121
132 Ga0495676_0185775 3300047321 Unclassified 1453
133 Ga0495680_0003402 3300047322 Bacteria 15700
134 Ga0495684_0069616 3300047471 Unclassified 2675
135 Ga0501031_0195486 3300049568 Unclassified 1320
136 Ga0501032_0025659 3300049569 Bacteria 4062
137 Ga0501033_0034816 3300049570 Bacteria 3775
138 Ga0501033_0057911 3300049570 Unclassified 2863
139 Ga0501037_0038539 3300049573 Bacteria 3521
140 Ga0501039_0549001 3300049575 Unclassified 907
141 Ga0501043_0071403 3300049579 Unclassified 2727
142 Ga0501046_0381634 3300049580 Unclassified 1020
143 Ga0501047_0870836 3300049581 Unclassified 714
144 Ga0501080_0342098 3300049742 Unclassified 1352
145 Ga0501035_0006916 3300049822 Bacteria 10594
146 Ga0501044_0028272 3300049823 Bacteria 5918
147 nmdc:mga0qj67_340854_c1 3300050509 Bacteria 1212
148 nmdc:mga0a205_461511_c1 3300050515 Unclassified 1129
149 Ga0500650_0290330 3300053098 Unclassified 726
150 Ga0070708_100084676
151 rootH2_10254140
152 rootL2_10240261
153 Ga0058859_10024264
154 Ga0058860_12032570
155 Ga0070690_100124529
156 Ga0070690_100501125
157 Ga0070677_10042299
158 Ga0068869_101084852
159 Ga0070666_10151424
160 Ga0070660_100124969
161 Ga0070689_100575491
162 Ga0070689_101121704
163 Ga0070689_101642271
164 Ga0070691_10175929
165 Ga0070675_101067566
166 Ga0070688_100292273
167 Ga0070700_100799123
168 Ga0070694_100153003
169 Ga0070681_10246575
170 Ga0070679_100270312
171 Ga0070684_100175376
172 Ga0070684_100615525
173 Ga0070704_101348599
174 Ga0068855_100171285
175 Ga0068857_100308638
176 Ga0068856_101453427
177 Ga0068859_100063230
178 Ga0068859_100369702
179 Ga0068861_100216169
180 Ga0068863_100010044
181 Ga0068858_100063174
182 Ga0075430_100352205
183 Ga0097620_100063229
184 Ga0097620_100369681
185 Ga0099794_10415379
186 Ga0105240_10028396
187 Ga0111539_10072364
188 Ga0105238_10938957
189 Ga0157370_10074368
190 Ga0157369_10692289
191 Ga0157378_10557149
192 Ga0157372_10486785
193 Ga0157372_12183200
194 Ga0157375_10773105
195 Ga0163163_10000126
196 Ga0163163_10103424
197 Ga0157380_12274964
198 Ga0207680_10163481
199 Ga0207705_10113014
200 Ga0207695_10474154
201 Ga0207693_10434727
202 Ga0207652_10641804
203 Ga0207670_10658114
204 Ga0207670_10971805
205 Ga0207661_10207833
206 Ga0207667_10917974
207 Ga0207703_10040370
208 Ga0207708_10192385
209 Ga0207641_10009532
210 Ga0207674_10673487
211 Ga0207675_100607811
212 Ga0207675_101481038
213 Ga0268265_10929438
214 Ga0265337_1002437
215 Ga0265326_10144221
216 Ga0265319_1013277
217 Ga0265322_10145881
218 Ga0265336_10004207
219 Ga0265338_10000208
220 Ga0265338_10002629
221 Ga0265338_10011590
222 Ga0265338_10012183
223 Ga0265338_10016394
224 Ga0265338_10022950
225 Ga0265338_10034147
226 Ga0265338_10043600
227 Ga0265338_10222574
228 Ga0265338_10297640
229 Ga0265338_10538081
230 Ga0265324_10240558
231 Ga0265328_10122669
232 Ga0265320_10016477
233 Ga0265320_10036079
234 Ga0265340_10082411
235 Ga0265340_10115613
236 Ga0265327_10013775
237 Ga0265316_10764595
238 Ga0265313_10221505
239 Ga0307416_101913200
240 Ga0373954_0007008
241 Ga0373956_0041233
242 Ga0373955_0109989
243 Ga0373933_0021200
244 Ga0373947_0100063
245 Ga0373937_0015756
246 Ga0373925_0164378
247 Ga0451577_0265555
248 Ga0451577_1317911
249 Ga0453683_0255701
250 Ga0453684_0007853
251 Ga0453684_0154478
252 Ga0451576_0276992
253 Ga0451576_0312270
254 Ga0451576_0328625
255 Ga0451576_1084530
256 Ga0495592_0402042
257 Ga0495629_0106474
258 Ga0495641_0074796
259 Ga0495582_0009809
260 Ga0495639_0366019
261 Ga0495662_0170173
262 Ga0495618_0000552
263 Ga0495628_0639710
264 Ga0495630_0003088
265 Ga0495630_0064373
266 Ga0495630_0210820
267 Ga0495630_0719854
268 Ga0495630_0900990
269 Ga0495666_0003511
270 Ga0495665_0056762
271 Ga0495586_0001822
272 Ga0495586_0010887
273 Ga0495598_0327095
274 Ga0495634_0000669
275 Ga0495634_0015455
276 Ga0495647_0145421
277 Ga0495658_0010588
278 Ga0495613_0017561
279 Ga0495613_0022908
280 Ga0495674_0004712
281 Ga0495676_0185775
282 Ga0495680_0003402
283 Ga0495684_0069616
284 Ga0501031_0195486
285 Ga0501032_0025659
286 Ga0501033_0034816
287 Ga0501033_0057911
288 Ga0501037_0038539
289 Ga0501039_0549001
290 Ga0501043_0071403
291 Ga0501046_0381634
292 Ga0501047_0870836
293 Ga0501080_0342098
294 Ga0501035_0006916
295 Ga0501044_0028272
296 nmdc:mga0qj67_340854_c1
297 nmdc:mga0a205_461511_c1
298 Ga0500650_0290330

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iys-assembly1.cif.gz_O-2 loop deletion and proline insertion mutant (deleting six residues and inserted three proline residues) 0.8944 70 98
6j49-assembly1.cif.gz_O grafting vladv sequence into ospasm1 0.8572 70 102
6j48-assembly1.cif.gz_O glycine mutation on single layer beta-sheet of ospasm1 0.8531 70 102
6idc-assembly1.cif.gz_A-2 loop deletion and proline insertion mutant (deleting six residues and inserted six proline residues) 0.8522 70 101
6kt1-assembly1.cif.gz_O crystal structure of an ospa mutant 0.8515 70 102
ID Description Score Start End Superfamily
af_A3FPI5_259_472_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7731 69 104 2.130.10.10
1p4pA00 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3; 0.7655 70 102 3.90.930.1
2eenB00 Mainly Beta;Beta Barrel;Hypothetical Protein Pfu-838710-001;Hypothetical Protein Pfu-838710-001 0.7592 70 113 2.40.320.10
af_A2ACJ2_1_446_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7451 72 100 2.130.10.10
3qdeB01 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5;Glycoside hydrolase, family 65, N-terminal domain 0.7341 70 100 2.70.98.40
ID Description Score Start End GO Terms
AF-A0A3M1CN01-F1-model_v4 DUF1257 domain-containing protein 0.8817 72 157
AF-A0A3C0AQV7-F1-model_v4 DUF1257 domain-containing protein 0.879 51 155
AF-A0A1F5VYP9-F1-model_v4 DUF1257 domain-containing protein 0.8526 7 156
AF-A0A1F7S0I3-F1-model_v4 DUF1257 domain-containing protein 0.8436 6 156
AF-A0A3C0AQV7-F1-model_v4 DUF1257 domain-containing protein 0.8345 51 155

Map