F205054

General Info

Members Datasets Scaffolds Average Seq Length
149 124 149 63

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100076193|Ga0068869_1000761934
Length 70
Sequence LAEVNPYRMKVAEILRRLRDAGWYLACTRGSHRQFKHPSRPGRVTVPGKVSDDLAPGTLNSILKQAGLRR

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
44 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
71 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
72 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
73 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
74 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
75 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
76 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
82 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
83 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
84 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
85 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
89 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
90 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
91 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
92 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
93 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
94 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
95 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
108 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
109 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
110 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
118 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
119 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
120 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
121 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
122 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
123 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
124 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.99
Metatranscriptomes 2.01
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.7
Nodule 0
Rhizoplane 3.36
Rhizosphere 89.93
Stem 0
Stem Tuber 0
Unclassified 2.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10703537 3300005295 Unclassified 638
2 Ga0068869_100076193 3300005334 Bacteria 2493
3 Ga0070682_100015389 3300005337 Bacteria 4432
4 Ga0070682_100044047 3300005337 Unclassified 2762
5 Ga0070692_10510907 3300005345 Unclassified 780
6 Ga0070673_100026500 3300005364 Bacteria 4282
7 Ga0070663_101294668 3300005455 Unclassified 643
8 Ga0070681_10045839 3300005458 Bacteria 4373
9 Ga0070681_10171786 3300005458 Bacteria 2089
10 Ga0070681_11961844 3300005458 Bacteria 513
11 Ga0070706_100151888 3300005467 Unclassified 2162
12 Ga0070706_102139240 3300005467 Unclassified 506
13 Ga0070679_100160536 3300005530 Bacteria 2222
14 Ga0068853_100545633 3300005539 Bacteria 1098
15 Ga0068853_102064987 3300005539 Unclassified 553
16 Ga0070695_100041555 3300005545 Bacteria 2915
17 Ga0070665_101366836 3300005548 Unclassified 718
18 Ga0070704_100626384 3300005549 Unclassified 948
19 Ga0068855_100274257 3300005563 Unclassified 1875
20 Ga0068855_100274592 3300005563 Unclassified 1873
21 Ga0068855_101203544 3300005563 Bacteria 788
22 Ga0068859_100254992 3300005617 Bacteria 1845
23 Ga0068861_100245730 3300005719 Unclassified 1524
24 Ga0068863_100007033 3300005841 Bacteria 11025
25 Ga0068858_100289107 3300005842 Unclassified 1562
26 Ga0068860_100001034 3300005843 Bacteria 30629
27 Ga0081455_10000879 3300005937 Bacteria 38878
28 Ga0081540_1036111 3300005983 Unclassified 2640
29 Ga0081539_10130823 3300005985 Bacteria 1233
30 Ga0075362_10779918 3300006177 Unclassified 502
31 Ga0097621_100201890 3300006237 Bacteria 1726
32 Ga0068871_100021838 3300006358 Bacteria 4927
33 Ga0068865_100006789 3300006881 Bacteria 7006
34 Ga0075436_100012989 3300006914 Bacteria 5710
35 Ga0097620_100254979 3300006931 Bacteria 1845
36 Ga0075435_100626032 3300007076 Unclassified 934
37 Ga0105240_12479102 3300009093 Unclassified 536
38 Ga0105243_10907452 3300009148 Unclassified 877
39 Ga0105242_10430853 3300009176 Bacteria 1238
40 Ga0105248_10057550 3300009177 Bacteria 4364
41 Ga0105248_11305295 3300009177 Unclassified 821
42 Ga0105237_10065777 3300009545 Bacteria 3620
43 Ga0105238_10285691 3300009551 Bacteria 1632
44 Ga0105238_10844764 3300009551 Bacteria 933
45 Ga0105249_10911366 3300009553 Unclassified 946
46 Ga0105239_10574404 3300010375 Bacteria 1285
47 Ga0157369_12000317 3300013105 Unclassified 588
48 Ga0163162_13250781 3300013306 Unclassified 521
49 Ga0157380_13228318 3300014326 Bacteria 521
50 Ga0157377_10516269 3300014745 Bacteria 838
51 Ga0157376_10010495 3300014969 Bacteria 6779
52 Ga0157376_10018228 3300014969 Bacteria 5376
53 Ga0209437_103739 3300025233 Bacteria 2721
54 Ga0209233_1001897 3300025261 Bacteria 8020
55 Ga0207707_10171822 3300025912 Bacteria 1894
56 Ga0207707_10971985 3300025912 Bacteria 698
57 Ga0207657_10180499 3300025919 Bacteria 1706
58 Ga0207646_11098830 3300025922 Bacteria 700
59 Ga0207664_10648201 3300025929 Unclassified 949
60 Ga0207711_10298788 3300025941 Unclassified 1485
61 Ga0207667_10201653 3300025949 Unclassified 2041
62 Ga0207667_10317113 3300025949 Bacteria 1592
63 Ga0207712_11361397 3300025961 Unclassified 635
64 Ga0207658_10007816 3300025986 Bacteria 7284
65 Ga0207639_11375601 3300026041 Unclassified 662
66 Ga0207678_10032749 3300026067 Unclassified 4530
67 Ga0207641_10000106 3300026088 Bacteria 121316
68 Ga0207675_100043798 3300026118 Bacteria 4180
69 Ga0207683_11572370 3300026121 Bacteria 607
70 Ga0265356_1001393 3300028017 Bacteria 3616
71 Ga0268264_10000188 3300028381 Bacteria 129042
72 Ga0265760_10239125 3300031090 Bacteria 625
73 Ga0265340_10026108 3300031247 Bacteria 2953
74 Ga0265331_10171771 3300031250 Bacteria 981
75 Ga0307408_100616459 3300031548 Bacteria 966
76 Ga0307408_101253648 3300031548 Unclassified 693
77 Ga0265342_10663077 3300031712 Unclassified 523
78 Ga0307405_10335280 3300031731 Bacteria 1161
79 Ga0307406_11341186 3300031901 Unclassified 625
80 Ga0307411_10242175 3300032005 Bacteria 1413
81 Ga0307415_101128639 3300032126 Unclassified 735
82 Ga0316593_10009211 3300032168 Bacteria 2781
83 Ga0316593_10069356 3300032168 Bacteria 1217
84 Ga0373926_0342849 3300035083 Bacteria 586
85 Ga0373929_0000013 3300035085 Bacteria 159542
86 Ga0373934_0230060 3300035086 Bacteria 765
87 Ga0373953_0256897 3300035117 Bacteria 760
88 Ga0373956_0041944 3300035119 Bacteria 2033
89 Ga0373955_0010984 3300035172 Unclassified 4299
90 Ga0316574_0203688 3300035398 Bacteria 1271
91 Ga0373937_0002423 3300036401 Bacteria 15512
92 Ga0373925_1382769 3300037068 Unclassified 577
93 Ga0436364_0362043 3300037853 Unclassified 587
94 Ga0436365_0691579 3300039437 Bacteria 4032
95 Ga0436360_0132454 3300039438 Bacteria 867
96 Ga0436360_0178637 3300039438 Bacteria 747
97 Ga0436362_0888945 3300039453 Unclassified 750
98 Ga0436362_1066158 3300039453 Bacteria 766
99 Ga0451791_0765725 3300041451 Unclassified 618
100 Ga0451793_1211426 3300041452 Unclassified 751
101 Ga0451793_1378792 3300041452 Bacteria 796
102 Ga0451802_0800334 3300041460 Bacteria 791
103 Ga0451577_0252052 3300042876 Bacteria 1598
104 Ga0451576_1703795 3300045051 Bacteria 653
105 Ga0495630_0676315 3300046517 Bacteria 790
106 Ga0495640_0130088 3300046533 Bacteria 1630
107 Ga0495647_0410578 3300046681 Unclassified 623
108 Ga0495593_0384169 3300047673 Bacteria 702
109 Ga0496107_0686616 3300048910 Bacteria 753
110 Ga0496125_0522311 3300048928 Unclassified 663
111 Ga0495682_0043990 3300049460 Bacteria 1635
112 Ga0501031_0167770 3300049568 Bacteria 1434
113 Ga0501032_0249357 3300049569 Bacteria 1153
114 Ga0501033_0000932 3300049570 Bacteria 26712
115 Ga0501034_1118048 3300049571 Bacteria 668
116 Ga0501036_0202645 3300049572 Bacteria 1669
117 Ga0501041_0112827 3300049577 Bacteria 1687
118 Ga0501043_0529118 3300049579 Bacteria 878
119 Ga0501046_0079555 3300049580 Bacteria 2534
120 Ga0501046_0369576 3300049580 Bacteria 1039
121 Ga0501047_0195905 3300049581 Bacteria 1883
122 Ga0501048_0541794 3300049582 Bacteria 835
123 Ga0501072_0267956 3300049588 Bacteria 1359
124 Ga0501073_0072969 3300049589 Bacteria 2390
125 Ga0501073_0290216 3300049589 Bacteria 1129
126 Ga0501074_0369984 3300049590 Bacteria 1017
127 Ga0501075_0030750 3300049591 Unclassified 3979
128 Ga0501075_0040152 3300049591 Bacteria 3504
129 Ga0501075_0261979 3300049591 Bacteria 1318
130 Ga0501076_0097357 3300049592 Bacteria 2370
131 Ga0501076_0179478 3300049592 Bacteria 1726
132 Ga0501079_0112801 3300049741 Bacteria 2113
133 Ga0501079_0296796 3300049741 Bacteria 1264
134 Ga0501080_0329503 3300049742 Bacteria 1381
135 Ga0501081_0095879 3300049743 Bacteria 2092
136 Ga0501035_1572780 3300049822 Unclassified 500
137 Ga0501044_0050371 3300049823 Bacteria 4297
138 Ga0501045_0157576 3300049824 Bacteria 1689
139 nmdc:mga09592_104297_c1 3300050508 Bacteria 2430
140 nmdc:mga09592_659124_c1 3300050508 Unclassified 893
141 nmdc:mga0rr50_1809091_c1 3300050513 Unclassified 514
142 nmdc:mga0rr50_696689_c1 3300050513 Unclassified 867
143 nmdc:mga08x19_27597_c1 3300050514 Bacteria 3551
144 Ga0500610_0000190 3300053079 Bacteria 18536
145 Ga0500556_0154887 3300053104 Bacteria 904
146 Ga0500588_0062054 3300053146 Bacteria 1201
147 Ga0500587_025912 3300053739 Bacteria 784
148 Ga0501084_0120537 3300054114 Bacteria 2206
149 Ga0501082_0020360 3300060353 Bacteria 5720

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025922 Ga0207646_11098830 Ga0207646_110988302 57
2 3300005337 Ga0070682_100044047 Ga0070682_1000440472 59
3 3300049569 Ga0501032_0249357 Ga0501032_0249357_275_454 59
4 3300049577 Ga0501041_0112827 Ga0501041_0112827_357_536 59
5 3300049579 Ga0501043_0529118 Ga0501043_0529118_463_642 59
6 3300049580 Ga0501046_0369576 Ga0501046_0369576_497_676 59
7 3300049582 Ga0501048_0541794 Ga0501048_0541794_339_518 59
8 3300049589 Ga0501073_0072969 Ga0501073_0072969_1607_1786 59
9 3300049590 Ga0501074_0369984 Ga0501074_0369984_408_587 59
10 3300049591 Ga0501075_0040152 Ga0501075_0040152_842_1021 59
11 3300049592 Ga0501076_0179478 Ga0501076_0179478_1098_1277 59
12 3300049741 Ga0501079_0296796 Ga0501079_0296796_204_383 59
13 3300049743 Ga0501081_0095879 Ga0501081_0095879_1093_1272 59
14 3300049823 Ga0501044_0050371 Ga0501044_0050371_62_241 59
15 3300049824 Ga0501045_0157576 Ga0501045_0157576_1201_1380 59
16 3300054114 Ga0501084_0120537 Ga0501084_0120537_1558_1737 59
17 3300060353 Ga0501082_0020360 Ga0501082_0020360_2794_2973 59
18 3300041452 Ga0451793_1378792 Ga0451793_1378792_245_430 60
19 3300005337 Ga0070682_100015389 Ga0070682_1000153897 61
20 3300005345 Ga0070692_10510907 Ga0070692_105109071 61
21 3300005364 Ga0070673_100026500 Ga0070673_1000265003 61
22 3300005458 Ga0070681_10045839 Ga0070681_100458396 61
23 3300005458 Ga0070681_10171786 Ga0070681_101717861 61
24 3300005458 Ga0070681_11961844 Ga0070681_119618441 61
25 3300005467 Ga0070706_100151888 Ga0070706_1001518883 61
26 3300005467 Ga0070706_102139240 Ga0070706_1021392402 61
27 3300005530 Ga0070679_100160536 Ga0070679_1001605364 61
28 3300005539 Ga0068853_100545633 Ga0068853_1005456333 61
29 3300005539 Ga0068853_102064987 Ga0068853_1020649871 61
30 3300005545 Ga0070695_100041555 Ga0070695_1000415552 61
31 3300005548 Ga0070665_101366836 Ga0070665_1013668362 61
32 3300005549 Ga0070704_100626384 Ga0070704_1006263843 61
33 3300005563 Ga0068855_100274257 Ga0068855_1002742572 61
34 3300005563 Ga0068855_100274592 Ga0068855_1002745925 61
35 3300005563 Ga0068855_101203544 Ga0068855_1012035442 61
36 3300005617 Ga0068859_100254992 Ga0068859_1002549921 61
37 3300005719 Ga0068861_100245730 Ga0068861_1002457302 61
38 3300005841 Ga0068863_100007033 Ga0068863_10000703310 61
39 3300005843 Ga0068860_100001034 Ga0068860_10000103412 61
40 3300005985 Ga0081539_10130823 Ga0081539_101308233 61
41 3300006177 Ga0075362_10779918 Ga0075362_107799181 61
42 3300006358 Ga0068871_100021838 Ga0068871_1000218386 61
43 3300006881 Ga0068865_100006789 Ga0068865_1000067899 61
44 3300006914 Ga0075436_100012989 Ga0075436_1000129896 61
45 3300006931 Ga0097620_100254979 Ga0097620_1002549794 61
46 3300007076 Ga0075435_100626032 Ga0075435_1006260322 61
47 3300009093 Ga0105240_12479102 Ga0105240_124791021 61
48 3300009148 Ga0105243_10907452 Ga0105243_109074521 61
49 3300009176 Ga0105242_10430853 Ga0105242_104308532 61
50 3300009177 Ga0105248_10057550 Ga0105248_100575503 61
51 3300009177 Ga0105248_11305295 Ga0105248_113052953 61
52 3300009545 Ga0105237_10065777 Ga0105237_100657773 61
53 3300009551 Ga0105238_10285691 Ga0105238_102856911 61
54 3300009551 Ga0105238_10844764 Ga0105238_108447642 61
55 3300009553 Ga0105249_10911366 Ga0105249_109113663 61
56 3300010375 Ga0105239_10574404 Ga0105239_105744041 61
57 3300013105 Ga0157369_12000317 Ga0157369_120003172 61
58 3300013306 Ga0163162_13250781 Ga0163162_132507811 61
59 3300014326 Ga0157380_13228318 Ga0157380_132283181 61
60 3300014745 Ga0157377_10516269 Ga0157377_105162692 61
61 3300014969 Ga0157376_10010495 Ga0157376_100104957 61
62 3300014969 Ga0157376_10018228 Ga0157376_100182284 61
63 3300025233 Ga0209437_103739 Ga0209437_1037392 61
64 3300025261 Ga0209233_1001897 Ga0209233_10018978 61
65 3300025912 Ga0207707_10171822 Ga0207707_101718223 61
66 3300025912 Ga0207707_10971985 Ga0207707_109719851 61
67 3300025919 Ga0207657_10180499 Ga0207657_101804995 61
68 3300025929 Ga0207664_10648201 Ga0207664_106482012 61
69 3300025941 Ga0207711_10298788 Ga0207711_102987883 61
70 3300025949 Ga0207667_10201653 Ga0207667_102016532 61
71 3300025949 Ga0207667_10317113 Ga0207667_103171133 61
72 3300025961 Ga0207712_11361397 Ga0207712_113613972 61
73 3300025986 Ga0207658_10007816 Ga0207658_100078164 61
74 3300026041 Ga0207639_11375601 Ga0207639_113756012 61
75 3300026067 Ga0207678_10032749 Ga0207678_100327491 61
76 3300026088 Ga0207641_10000106 Ga0207641_1000010660 61
77 3300026118 Ga0207675_100043798 Ga0207675_1000437981 61
78 3300026121 Ga0207683_11572370 Ga0207683_115723702 61
79 3300028017 Ga0265356_1001393 Ga0265356_10013933 61
80 3300028381 Ga0268264_10000188 Ga0268264_1000018814 61
81 3300031090 Ga0265760_10239125 Ga0265760_102391251 61
82 3300031247 Ga0265340_10026108 Ga0265340_100261086 61
83 3300031250 Ga0265331_10171771 Ga0265331_101717712 61
84 3300031548 Ga0307408_101253648 Ga0307408_1012536482 61
85 3300031712 Ga0265342_10663077 Ga0265342_106630772 61
86 3300031731 Ga0307405_10335280 Ga0307405_103352803 61
87 3300031901 Ga0307406_11341186 Ga0307406_113411862 61
88 3300032005 Ga0307411_10242175 Ga0307411_102421752 61
89 3300032126 Ga0307415_101128639 Ga0307415_1011286391 61
90 3300032168 Ga0316593_10009211 Ga0316593_100092114 61
91 3300032168 Ga0316593_10069356 Ga0316593_100693561 61
92 3300035083 Ga0373926_0342849 Ga0373926_0342849_154_348 61
93 3300035085 Ga0373929_0000013 Ga0373929_0000013_64582_64770 61
94 3300035086 Ga0373934_0230060 Ga0373934_0230060_430_624 61
95 3300035117 Ga0373953_0256897 Ga0373953_0256897_344_538 61
96 3300035119 Ga0373956_0041944 Ga0373956_0041944_1430_1624 61
97 3300035172 Ga0373955_0010984 Ga0373955_0010984_701_895 61
98 3300035398 Ga0316574_0203688 Ga0316574_0203688_42_227 61
99 3300036401 Ga0373937_0002423 Ga0373937_0002423_237_431 61
100 3300037068 Ga0373925_1382769 Ga0373925_1382769_114_308 61
101 3300037853 Ga0436364_0362043 Ga0436364_0362043_196_384 61
102 3300039437 Ga0436365_0691579 Ga0436365_0691579_364_558 61
103 3300039438 Ga0436360_0132454 Ga0436360_0132454_338_526 61
104 3300039438 Ga0436360_0178637 Ga0436360_0178637_518_718 61
105 3300039453 Ga0436362_0888945 Ga0436362_0888945_272_460 61
106 3300039453 Ga0436362_1066158 Ga0436362_1066158_229_417 61
107 3300041451 Ga0451791_0765725 Ga0451791_0765725_259_450 61
108 3300041452 Ga0451793_1211426 Ga0451793_1211426_77_265 61
109 3300041460 Ga0451802_0800334 Ga0451802_0800334_182_370 61
110 3300046517 Ga0495630_0676315 Ga0495630_0676315_584_772 61
111 3300046533 Ga0495640_0130088 Ga0495640_0130088_1137_1331 61
112 3300046681 Ga0495647_0410578 Ga0495647_0410578_120_308 61
113 3300047673 Ga0495593_0384169 Ga0495593_0384169_474_668 61
114 3300048928 Ga0496125_0522311 Ga0496125_0522311_33_227 61
115 3300049460 Ga0495682_0043990 Ga0495682_0043990_387_572 61
116 3300049568 Ga0501031_0167770 Ga0501031_0167770_705_893 61
117 3300049570 Ga0501033_0000932 Ga0501033_0000932_16488_16676 61
118 3300049572 Ga0501036_0202645 Ga0501036_0202645_960_1154 61
119 3300049580 Ga0501046_0079555 Ga0501046_0079555_446_637 61
120 3300049581 Ga0501047_0195905 Ga0501047_0195905_1473_1667 61
121 3300049588 Ga0501072_0267956 Ga0501072_0267956_174_362 61
122 3300049589 Ga0501073_0290216 Ga0501073_0290216_855_1049 61
123 3300049591 Ga0501075_0030750 Ga0501075_0030750_285_473 61
124 3300049591 Ga0501075_0261979 Ga0501075_0261979_224_418 61
125 3300049592 Ga0501076_0097357 Ga0501076_0097357_1487_1675 61
126 3300049741 Ga0501079_0112801 Ga0501079_0112801_666_854 61
127 3300049742 Ga0501080_0329503 Ga0501080_0329503_253_441 61
128 3300049822 Ga0501035_1572780 Ga0501035_1572780_134_328 61
129 3300050508 nmdc:mga09592_104297_c1 nmdc:mga09592_104297_c1_2126_2317 61
130 3300050508 nmdc:mga09592_659124_c1 nmdc:mga09592_659124_c1_675_866 61
131 3300050513 nmdc:mga0rr50_1809091_c1 nmdc:mga0rr50_1809091_c1_192_380 61
132 3300050513 nmdc:mga0rr50_696689_c1 nmdc:mga0rr50_696689_c1_406_594 61
133 3300050514 nmdc:mga08x19_27597_c1 nmdc:mga08x19_27597_c1_623_811 61
134 3300053079 Ga0500610_0000190 Ga0500610_0000190_9039_9224 61
135 3300053104 Ga0500556_0154887 Ga0500556_0154887_255_443 61
136 3300053146 Ga0500588_0062054 Ga0500588_0062054_388_573 61
137 3300053739 Ga0500587_025912 Ga0500587_025912_405_593 61
138 3300005455 Ga0070663_101294668 Ga0070663_1012946681 62
139 3300042876 Ga0451577_0252052 Ga0451577_0252052_735_926 62
140 3300045051 Ga0451576_1703795 Ga0451576_1703795_266_457 62
141 3300005334 Ga0068869_100076193 Ga0068869_1000761934 63
142 3300005842 Ga0068858_100289107 Ga0068858_1002891071 63
143 3300005937 Ga0081455_10000879 Ga0081455_1000087920 63
144 3300005983 Ga0081540_1036111 Ga0081540_10361114 63
145 3300006237 Ga0097621_100201890 Ga0097621_1002018903 63
146 3300031548 Ga0307408_100616459 Ga0307408_1006164592 63
147 3300048910 Ga0496107_0686616 Ga0496107_0686616_356_568 63
148 3300049571 Ga0501034_1118048 Ga0501034_1118048_150_353 63
149 3300005295 Ga0065707_10703537 Ga0065707_107035371 64

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07927

HicA_toxin

HicA toxin of bacterial toxin-antitoxin,

11

68

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g26-assembly1.cif.gz_F the crystal structure of the burkholderia pseudomallei hicab complex 0.9427 3 62
6g26-assembly1.cif.gz_F the crystal structure of the burkholderia pseudomallei hicab complex 0.8983 3 62
1whz-assembly1.cif.gz_A crystal structure of a hypothetical protein from thermus thermophilus hb8 0.8774 1 64
5yrz-assembly1.cif.gz_D toxin-antitoxin complex from streptococcus pneumoniae 0.8584 4 62
4c26-assembly1.cif.gz_A solution nmr structure of the hica toxin from burkholderia pseudomallei 0.8393 7 62
ID Description Score Start End Superfamily
6g26F00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.9427 3 62 3.30.920.30
6g26F00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8983 3 62 3.30.920.30
1whzA00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8599 1 64 3.30.920.30
5yrzD00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8584 4 62 3.30.920.30
4c26A00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8393 7 62 3.30.920.30
ID Description Score Start End GO Terms
AF-A0A7V9ECI5-F1-model_v4 Type II toxin-antitoxin system HicA family toxin 0.9911 3 64 GO:0003729
GO:0004519
AF-A0A4V1ZWH9-F1-model_v4 Addiction module toxin, HicA family 0.9895 1 64 GO:0003729
GO:0004519
AF-A0A831ULB5-F1-model_v4 Addiction module toxin, HicA family 0.9884 3 64 GO:0003729
GO:0004519
AF-A0A6G2K4B3-F1-model_v4 Type II toxin-antitoxin system HicA family toxin 0.9863 3 64 GO:0003729
GO:0004519
AF-A0A2V7VTW1-F1-model_v4 Addiction module toxin, HicA family 0.9861 2 64 GO:0003729
GO:0004519

Feature Viewer

pLDDT pTM Quality
92.12 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map