F204017

General Info

Members Datasets Scaffolds Average Seq Length
148 85 296 247

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0000073|Ga0451576_0000073_201007_201858
Length 283
Sequence MISFSQDLTILRSHLLLAWIAKSRPKRKEAGMIFEVCIDSVEGALAAQAAGAQRVELCDNLVEGGTTPSLGMLSVIRDQVSLEVNVIIRPRGGDFCYSELEFEVMLRDVQAARAAGADGVVLGLLLPDGTIDRERTRRLIAAARPLSVTFHRAFDLCRDPAEALETLIDLGVDRVLTSGQKRSAPEGADCIAKLVRQAGERIIILAGGGVTAETLSALAAATGIRECHFSARRTVPSPMQYRNLEATMGKAYQPDEYSRRVPDEALIRAVIHSADSLPDRFSP

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
17 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
18 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
19 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
41 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
42 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
43 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
44 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
45 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
46 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
47 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
48 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
49 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
50 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
51 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
52 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
53 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
54 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
55 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
56 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
57 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
58 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
59 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
60 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
61 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
62 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
63 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
68 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
69 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
70 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
71 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
72 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
73 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
74 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
75 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
76 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
77 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
78 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
79 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
80 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
81 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
82 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
83 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
84 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
85 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.35
Rhizosphere 97.97
Stem 0
Stem Tuber 0
Unclassified 18.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0000073 3300045051 Bacteria 253094
2 Ga0070680_100025472 3300005336 Bacteria 4729
3 Ga0070680_100168624 3300005336 Bacteria 1841
4 Ga0070714_100099113 3300005435 Unclassified 2564
5 Ga0070713_100718927 3300005436 Unclassified 954
6 Ga0070708_100396702 3300005445 Bacteria 1301
7 Ga0070681_10020530 3300005458 Bacteria 6621
8 Ga0070681_10360769 3300005458 Unclassified 1363
9 Ga0070698_100029073 3300005471 Bacteria 5735
10 Ga0070698_100048370 3300005471 Bacteria 4345
11 Ga0070699_100006398 3300005518 Bacteria 10260
12 Ga0070699_100355836 3300005518 Bacteria 1319
13 Ga0070679_100331071 3300005530 Unclassified 1471
14 Ga0070697_100127997 3300005536 Bacteria 2128
15 Ga0070697_100648079 3300005536 Bacteria 930
16 Ga0070695_100236527 3300005545 Bacteria 1323
17 Ga0070696_100025883 3300005546 Bacteria 3991
18 Ga0070696_100428345 3300005546 Bacteria 1040
19 Ga0070704_100021703 3300005549 Bacteria 4167
20 Ga0070704_100340736 3300005549 Bacteria 1262
21 Ga0070704_100730030 3300005549 Unclassified 880
22 Ga0068859_100912352 3300005617 Bacteria 963
23 Ga0081539_10025359 3300005985 Bacteria 3821
24 Ga0070712_100543709 3300006175 Unclassified 978
25 Ga0075429_100325915 3300006880 Unclassified 1344
26 Ga0068865_100275207 3300006881 Bacteria 1338
27 Ga0075436_100000737 3300006914 Bacteria 21698
28 Ga0075436_100142682 3300006914 Unclassified 1684
29 Ga0097620_100912420 3300006931 Bacteria 963
30 Ga0105240_10001132 3300009093 Bacteria 46700
31 Ga0105240_10046691 3300009093 Bacteria 5486
32 Ga0111539_10680270 3300009094 Bacteria 1198
33 Ga0114129_10123787 3300009147 Bacteria 3556
34 Ga0114129_10130765 3300009147 Bacteria 3448
35 Ga0114129_10556069 3300009147 Bacteria 1492
36 Ga0105249_10427149 3300009553 Bacteria 1360
37 Ga0105246_10410822 3300011119 Bacteria 1127
38 Ga0157369_10916344 3300013105 Bacteria 899
39 Ga0163162_10241175 3300013306 Bacteria 1939
40 Ga0157372_10127080 3300013307 Bacteria 2931
41 Ga0157372_10302201 3300013307 Unclassified 1861
42 Ga0157380_10332858 3300014326 Bacteria 1413
43 Ga0207653_10006234 3300025885 Bacteria 3719
44 Ga0207684_10037436 3300025910 Bacteria 4116
45 Ga0207707_10026315 3300025912 Bacteria 5085
46 Ga0207707_10029608 3300025912 Bacteria 4787
47 Ga0207695_10002568 3300025913 Bacteria 26676
48 Ga0207695_10145683 3300025913 Bacteria 2313
49 Ga0207660_10039968 3300025917 Bacteria 3281
50 Ga0207660_10059214 3300025917 Bacteria 2749
51 Ga0207652_10054735 3300025921 Unclassified 3430
52 Ga0207667_10238678 3300025949 Bacteria 1861
53 Ga0207703_10317622 3300026035 Bacteria 1425
54 Ga0207675_100379556 3300026118 Bacteria 1390
55 Ga0268264_10319759 3300028381 Bacteria 1467
56 Ga0265334_10089298 3300028573 Unclassified 1126
57 Ga0265338_10023754 3300028800 Bacteria 6288
58 Ga0265316_10133507 3300031344 Unclassified 1868
59 Ga0265316_10231608 3300031344 Bacteria 1360
60 Ga0316576_10000624 3300031727 Bacteria 17049
61 Ga0316578_10034090 3300031728 Bacteria 2921
62 Ga0307411_10449294 3300032005 Bacteria 1078
63 Ga0373936_0216655 3300035113 Unclassified 848
64 Ga0373946_0019965 3300035171 Bacteria 2586
65 Ga0373961_0041434 3300035241 Bacteria 1331
66 Ga0373935_0009075 3300035692 Bacteria 5951
67 Ga0373927_0000915 3300035695 Bacteria 22405
68 Ga0373927_0053486 3300035695 Bacteria 2612
69 Ga0373927_0280715 3300035695 Bacteria 1096
70 Ga0316584_0026315 3300036712 Unclassified 4276
71 Ga0316584_0048348 3300036712 Bacteria 3178
72 Ga0316584_0481922 3300036712 Unclassified 874
73 Ga0373925_0000570 3300037068 Bacteria 36123
74 Ga0373925_0003158 3300037068 Bacteria 12906
75 Ga0316581_0002147 3300037588 Unclassified 4644
76 Ga0436363_0235622 3300039450 Unclassified 3315
77 Ga0439439_0035019 3300041406 Bacteria 1289
78 Ga0451577_0082936 3300042876 Bacteria 2860
79 Ga0451577_0237198 3300042876 Bacteria 1650
80 Ga0453683_0000115 3300044673 Bacteria 118577
81 Ga0453683_0469993 3300044673 Bacteria 814
82 Ga0453684_0000584 3300044712 Bacteria 135892
83 Ga0453684_0016441 3300044712 Bacteria 11567
84 Ga0453684_0018379 3300044712 Bacteria 10730
85 Ga0453684_0021098 3300044712 Bacteria 9761
86 Ga0453684_0041933 3300044712 Bacteria 6177
87 Ga0453684_0076916 3300044712 Bacteria 4188
88 Ga0453684_0081164 3300044712 Bacteria 4046
89 Ga0453684_0236628 3300044712 Unclassified 2105
90 Ga0453684_0454186 3300044712 Bacteria 1426
91 Ga0453684_0774879 3300044712 Bacteria 1036
92 Ga0453684_0960709 3300044712 Bacteria 911
93 Ga0451576_0000308 3300045051 Bacteria 118556
94 Ga0451576_0002516 3300045051 Bacteria 27169
95 Ga0451576_0038480 3300045051 Bacteria 5062
96 Ga0451576_0134348 3300045051 Unclassified 2580
97 Ga0451576_0163868 3300045051 Bacteria 2320
98 Ga0451576_0170441 3300045051 Bacteria 2272
99 Ga0495630_0009880 3300046517 Bacteria 6873
100 Ga0495600_0378620 3300046809 Bacteria 883
101 Ga0496111_0405786 3300048914 Unclassified 1007
102 Ga0496114_0382338 3300048917 Bacteria 1246
103 Ga0501033_0030743 3300049570 Unclassified 4035
104 Ga0501034_0012082 3300049571 Bacteria 8927
105 Ga0501034_0067677 3300049571 Bacteria 3583
106 Ga0501036_0309449 3300049572 Unclassified 1321
107 Ga0501036_0319732 3300049572 Bacteria 1297
108 Ga0501036_0345803 3300049572 Bacteria 1242
109 Ga0501040_0346838 3300049576 Bacteria 1063
110 Ga0501067_0008667 3300049583 Bacteria 5637
111 Ga0501067_0013366 3300049583 Bacteria 4546
112 Ga0501068_0020464 3300049584 Bacteria 3854
113 Ga0501068_0083299 3300049584 Bacteria 1965
114 Ga0501069_0014366 3300049585 Bacteria 4232
115 Ga0501069_0018696 3300049585 Bacteria 3742
116 Ga0501069_0120078 3300049585 Bacteria 1501
117 Ga0501070_0020972 3300049586 Bacteria 5481
118 Ga0501070_0122803 3300049586 Bacteria 2146
119 Ga0501070_0281153 3300049586 Unclassified 1358
120 Ga0501071_0002940 3300049587 Bacteria 10521
121 Ga0501071_0015950 3300049587 Bacteria 5161
122 Ga0501072_0015870 3300049588 Bacteria 5773
123 Ga0501072_0063479 3300049588 Bacteria 2914
124 Ga0501073_0010511 3300049589 Bacteria 6782
125 Ga0501074_0008356 3300049590 Bacteria 7504
126 Ga0501074_0032739 3300049590 Bacteria 3765
127 Ga0501079_0014849 3300049741 Bacteria 5937
128 Ga0501080_0016116 3300049742 Bacteria 6899
129 Ga0501080_0255913 3300049742 Bacteria 1596
130 Ga0501080_0798485 3300049742 Bacteria 828
131 Ga0501081_0152805 3300049743 Bacteria 1659
132 Ga0501083_0013964 3300049744 Bacteria 5612
133 Ga0501083_0018442 3300049744 Bacteria 4863
134 Ga0501045_0069979 3300049824 Bacteria 2581
135 Ga0501045_0337873 3300049824 Bacteria 1121
136 nmdc:mga05p37_171785_c1 3300050507 Bacteria 2643
137 nmdc:mga05p37_31612_c1 3300050507 Bacteria 6467
138 nmdc:mga05p37_448888_c1 3300050507 Bacteria 1493
139 nmdc:mga05p37_772959_c1 3300050507 Unclassified 1055
140 nmdc:mga09592_330486_c1 3300050508 Unclassified 1320
141 nmdc:mga08x19_125705_c1 3300050514 Unclassified 1722
142 nmdc:mga08x19_689_c1 3300050514 Bacteria 21661
143 Ga0501084_0020337 3300054114 Bacteria 5534
144 Ga0501084_0029332 3300054114 Bacteria 4602
145 Ga0501082_0022861 3300060353 Bacteria 5386
146 Ga0501082_0047194 3300060353 Bacteria 3711
147 Ga0530510_0158748 3300061734 Bacteria 1672
148 Ga0530510_0408614 3300061734 Unclassified 1024
149 Ga0451576_0000073
150 Ga0070680_100025472
151 Ga0070680_100168624
152 Ga0070714_100099113
153 Ga0070713_100718927
154 Ga0070708_100396702
155 Ga0070681_10020530
156 Ga0070681_10360769
157 Ga0070698_100029073
158 Ga0070698_100048370
159 Ga0070699_100006398
160 Ga0070699_100355836
161 Ga0070679_100331071
162 Ga0070697_100127997
163 Ga0070697_100648079
164 Ga0070695_100236527
165 Ga0070696_100025883
166 Ga0070696_100428345
167 Ga0070704_100021703
168 Ga0070704_100340736
169 Ga0070704_100730030
170 Ga0068859_100912352
171 Ga0081539_10025359
172 Ga0070712_100543709
173 Ga0075429_100325915
174 Ga0068865_100275207
175 Ga0075436_100000737
176 Ga0075436_100142682
177 Ga0097620_100912420
178 Ga0105240_10001132
179 Ga0105240_10046691
180 Ga0111539_10680270
181 Ga0114129_10123787
182 Ga0114129_10130765
183 Ga0114129_10556069
184 Ga0105249_10427149
185 Ga0105246_10410822
186 Ga0157369_10916344
187 Ga0163162_10241175
188 Ga0157372_10127080
189 Ga0157372_10302201
190 Ga0157380_10332858
191 Ga0207653_10006234
192 Ga0207684_10037436
193 Ga0207707_10026315
194 Ga0207707_10029608
195 Ga0207695_10002568
196 Ga0207695_10145683
197 Ga0207660_10039968
198 Ga0207660_10059214
199 Ga0207652_10054735
200 Ga0207667_10238678
201 Ga0207703_10317622
202 Ga0207675_100379556
203 Ga0268264_10319759
204 Ga0265334_10089298
205 Ga0265338_10023754
206 Ga0265316_10133507
207 Ga0265316_10231608
208 Ga0316576_10000624
209 Ga0316578_10034090
210 Ga0307411_10449294
211 Ga0373936_0216655
212 Ga0373946_0019965
213 Ga0373961_0041434
214 Ga0373935_0009075
215 Ga0373927_0000915
216 Ga0373927_0053486
217 Ga0373927_0280715
218 Ga0316584_0026315
219 Ga0316584_0048348
220 Ga0316584_0481922
221 Ga0373925_0000570
222 Ga0373925_0003158
223 Ga0316581_0002147
224 Ga0436363_0235622
225 Ga0439439_0035019
226 Ga0451577_0082936
227 Ga0451577_0237198
228 Ga0453683_0000115
229 Ga0453683_0469993
230 Ga0453684_0000584
231 Ga0453684_0016441
232 Ga0453684_0018379
233 Ga0453684_0021098
234 Ga0453684_0041933
235 Ga0453684_0076916
236 Ga0453684_0081164
237 Ga0453684_0236628
238 Ga0453684_0454186
239 Ga0453684_0774879
240 Ga0453684_0960709
241 Ga0451576_0000308
242 Ga0451576_0002516
243 Ga0451576_0038480
244 Ga0451576_0134348
245 Ga0451576_0163868
246 Ga0451576_0170441
247 Ga0495630_0009880
248 Ga0495600_0378620
249 Ga0496111_0405786
250 Ga0496114_0382338
251 Ga0501033_0030743
252 Ga0501034_0012082
253 Ga0501034_0067677
254 Ga0501036_0309449
255 Ga0501036_0319732
256 Ga0501036_0345803
257 Ga0501040_0346838
258 Ga0501067_0008667
259 Ga0501067_0013366
260 Ga0501068_0020464
261 Ga0501068_0083299
262 Ga0501069_0014366
263 Ga0501069_0018696
264 Ga0501069_0120078
265 Ga0501070_0020972
266 Ga0501070_0122803
267 Ga0501070_0281153
268 Ga0501071_0002940
269 Ga0501071_0015950
270 Ga0501072_0015870
271 Ga0501072_0063479
272 Ga0501073_0010511
273 Ga0501074_0008356
274 Ga0501074_0032739
275 Ga0501079_0014849
276 Ga0501080_0016116
277 Ga0501080_0255913
278 Ga0501080_0798485
279 Ga0501081_0152805
280 Ga0501083_0013964
281 Ga0501083_0018442
282 Ga0501045_0069979
283 Ga0501045_0337873
284 nmdc:mga05p37_171785_c1
285 nmdc:mga05p37_31612_c1
286 nmdc:mga05p37_448888_c1
287 nmdc:mga05p37_772959_c1
288 nmdc:mga09592_330486_c1
289 nmdc:mga08x19_125705_c1
290 nmdc:mga08x19_689_c1
291 Ga0501084_0020337
292 Ga0501084_0029332
293 Ga0501082_0022861
294 Ga0501082_0047194
295 Ga0530510_0158748
296 Ga0530510_0408614

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03932

CutC

CutC family

32

233

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iwp-assembly4.cif.gz_A crystal structure of human copper homeostasis protein cutc 0.9654 3 225
3iwp-assembly5.cif.gz_D crystal structure of human copper homeostasis protein cutc 0.9615 5 222
3iwp-assembly5.cif.gz_C crystal structure of human copper homeostasis protein cutc 0.9593 3 222
2bdq-assembly1.cif.gz_B crystal structure of the putative copper homeostasis protein cutc from streptococcus agalactiae, northeast strucural genomics target sar15. 0.9566 5 179
3iwp-assembly4.cif.gz_B crystal structure of human copper homeostasis protein cutc 0.9516 3 226
ID Description Score Start End Superfamily
af_Q9D8X1_24_272_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.9738 5 226 3.20.20.380
af_P67826_1_248_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.9572 5 225 3.20.20.380
af_Q54K76_6_279_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.9532 5 226 3.20.20.380
af_Q9D8X1_24_272_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.953 5 226 3.20.20.380
af_Q4E0C3_1_211_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.9361 5 180 3.20.20.380
ID Description Score Start End GO Terms
AF-A0A1M6I4N1-F1-model_v4 Copper homeostasis protein cutC homolog 0.9987 6 83 GO:0005507
AF-A0A2V7H918-F1-model_v4 Copper homeostasis protein cutC homolog 0.9973 6 140 GO:0005507
AF-A0A7J8G782-F1-model_v4 Copper homeostasis protein cutC homolog 0.9963 8 113 GO:0005507
AF-A0A2E1DIN6-F1-model_v4 Copper homeostasis protein cutC homolog 0.9958 6 99 GO:0005507
AF-A0A2V7K9G5-F1-model_v4 Copper homeostasis protein cutC homolog 0.9939 1 149 GO:0005507

Map