F203998

General Info

Members Datasets Scaffolds Average Seq Length
148 68 296 130

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0548469|Ga0453684_0548469_54_503
Length 149
Sequence MGRFNLQFYAGRAQGEMMKIAEVSEQYSISSDTLRYYERIGLIPHVTRSESGIRDYNELDLRRVEFIKCMRSAGLPVEVLIDYVALVQQGDKTIEARKEILKEQRALLAARMKEMQKTLDILDHKIEVYENAVLKKEKEIVRVEEIEAI

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
46 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
47 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
48 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
49 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
50 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
51 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
52 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
53 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
54 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
55 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
56 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
57 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
58 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
59 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
60 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
61 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
62 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
63 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
64 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
65 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
66 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
67 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
68 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.35
Rhizosphere 97.3
Stem 0
Stem Tuber 0
Unclassified 20.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0548469 3300044712 Bacteria 1274
2 SwRhRL2b_contig_3027227 2162886007 Bacteria 1197
3 JGI25406J46586_10005654 3300003203 Bacteria 5782
4 JGI25406J46586_10007837 3300003203 Bacteria 4858
5 Ga0065707_10082025 3300005295 Bacteria 24254
6 Ga0065707_10224487 3300005295 Bacteria 1212
7 Ga0065707_10439692 3300005295 Bacteria 795
8 Ga0070669_101745044 3300005353 Unclassified 543
9 Ga0070705_100180662 3300005440 Unclassified 1429
10 Ga0070694_100545997 3300005444 Unclassified 927
11 Ga0070706_101708770 3300005467 Unclassified 573
12 Ga0070706_101965998 3300005467 Unclassified 530
13 Ga0070707_100150767 3300005468 Unclassified 2264
14 Ga0070698_100080814 3300005471 Unclassified 3245
15 Ga0070698_100201920 3300005471 Unclassified 1923
16 Ga0070699_100036881 3300005518 Bacteria 4229
17 Ga0070699_100269113 3300005518 Unclassified 1524
18 Ga0070699_100584892 3300005518 Bacteria 1017
19 Ga0070699_101302051 3300005518 Unclassified 666
20 Ga0070695_100626485 3300005545 Bacteria 847
21 Ga0070696_100954337 3300005546 Bacteria 714
22 Ga0070696_101358768 3300005546 Unclassified 605
23 Ga0070704_100098666 3300005549 Bacteria 2195
24 Ga0070704_101112609 3300005549 Bacteria 718
25 Ga0068857_100510667 3300005577 Bacteria 1129
26 Ga0068857_100982755 3300005577 Bacteria 812
27 Ga0070702_101280694 3300005615 Bacteria 594
28 Ga0068866_10521874 3300005718 Unclassified 789
29 Ga0068861_100555538 3300005719 Bacteria 1047
30 Ga0068860_100149511 3300005843 Bacteria 2249
31 Ga0068862_100075679 3300005844 Unclassified 2912
32 Ga0068862_101674143 3300005844 Bacteria 644
33 Ga0081539_10002731 3300005985 Bacteria 23852
34 Ga0075428_100039020 3300006844 Bacteria 5226
35 Ga0075428_100598780 3300006844 Bacteria 1177
36 Ga0075428_100744959 3300006844 Bacteria 1042
37 Ga0075430_100109387 3300006846 Bacteria 2305
38 Ga0075430_100519415 3300006846 Bacteria 982
39 Ga0075431_101373228 3300006847 Unclassified 666
40 Ga0075431_101737545 3300006847 Bacteria 580
41 Ga0075433_10321073 3300006852 Unclassified 1370
42 Ga0075433_10641299 3300006852 Bacteria 931
43 Ga0075434_100760412 3300006871 Bacteria 986
44 Ga0075429_100031423 3300006880 Bacteria 4614
45 Ga0075429_100106695 3300006880 Bacteria 2447
46 Ga0075429_100124661 3300006880 Bacteria 2252
47 Ga0075429_100612906 3300006880 Unclassified 954
48 Ga0075429_100622545 3300006880 Bacteria 946
49 Ga0075429_101106100 3300006880 Bacteria 692
50 Ga0105245_10456799 3300009098 Bacteria 1287
51 Ga0114129_10025283 3300009147 Bacteria 8414
52 Ga0114129_10033436 3300009147 Bacteria 7267
53 Ga0114129_10036108 3300009147 Bacteria 6980
54 Ga0114129_10435807 3300009147 Bacteria 1721
55 Ga0114129_11202154 3300009147 Bacteria 944
56 Ga0105243_10143495 3300009148 Bacteria 2040
57 Ga0105243_10787806 3300009148 Bacteria 936
58 Ga0105243_12315361 3300009148 Bacteria 575
59 Ga0105241_12108198 3300009174 Bacteria 557
60 Ga0105242_10644046 3300009176 Unclassified 1030
61 Ga0105246_10039413 3300011119 Bacteria 3183
62 Ga0157380_11267273 3300014326 Bacteria 783
63 Ga0157379_11620811 3300014968 Bacteria 632
64 Ga0207684_11476093 3300025910 Unclassified 554
65 Ga0207646_10063871 3300025922 Unclassified 3286
66 Ga0207709_10086844 3300025935 Bacteria 2032
67 Ga0207712_10182916 3300025961 Unclassified 1648
68 Ga0207674_10172573 3300026116 Bacteria 2115
69 Ga0207674_10649315 3300026116 Bacteria 1019
70 Ga0209981_1022951 3300027378 Unclassified 896
71 Ga0209968_1003905 3300027526 Unclassified 2237
72 Ga0268265_10178346 3300028380 Unclassified 1823
73 Ga0268264_10678317 3300028381 Bacteria 1022
74 Ga0268264_12254261 3300028381 Bacteria 552
75 Ga0265323_10011432 3300028653 Bacteria 3582
76 Ga0265323_10123921 3300028653 Bacteria 840
77 Ga0307408_101472462 3300031548 Bacteria 643
78 Ga0316575_10340886 3300031665 Bacteria 638
79 Ga0316576_10576961 3300031727 Unclassified 822
80 Ga0316578_10038798 3300031728 Bacteria 2749
81 Ga0316578_10286060 3300031728 Bacteria 987
82 Ga0316578_10651051 3300031728 Bacteria 615
83 Ga0316577_10675936 3300031733 Bacteria 587
84 Ga0307416_100611684 3300032002 Bacteria 1171
85 Ga0307416_101576679 3300032002 Bacteria 762
86 Ga0307411_10503218 3300032005 Bacteria 1025
87 Ga0316574_0447160 3300035398 Unclassified 810
88 Ga0316574_0591959 3300035398 Unclassified 686
89 Ga0316584_0172573 3300036712 Bacteria 1603
90 Ga0316584_0515252 3300036712 Bacteria 839
91 Ga0373925_0368376 3300037068 Bacteria 1169
92 Ga0400483_051997 3300039062 Bacteria 1298
93 Ga0451800_0679400 3300041459 Bacteria 890
94 Ga0451577_0004778 3300042876 Bacteria 14163
95 Ga0451577_0016145 3300042876 Bacteria 6922
96 Ga0451577_0340182 3300042876 Bacteria 1361
97 Ga0451577_0546284 3300042876 Bacteria 1052
98 Ga0453683_0014146 3300044673 Bacteria 5187
99 Ga0453683_0073749 3300044673 Bacteria 2136
100 Ga0453683_0093770 3300044673 Bacteria 1883
101 Ga0453683_0192466 3300044673 Bacteria 1294
102 Ga0453683_0362949 3300044673 Bacteria 931
103 Ga0453683_0363203 3300044673 Unclassified 931
104 Ga0453684_0000035 3300044712 Bacteria 725956
105 Ga0453684_0000232 3300044712 Bacteria 240951
106 Ga0453684_0000588 3300044712 Bacteria 135201
107 Ga0453684_0000658 3300044712 Bacteria 124108
108 Ga0453684_0001420 3300044712 Bacteria 68969
109 Ga0453684_0002913 3300044712 Bacteria 40117
110 Ga0453684_0003088 3300044712 Bacteria 38418
111 Ga0453684_0012243 3300044712 Bacteria 14205
112 Ga0453684_0021394 3300044712 Bacteria 9664
113 Ga0453684_0035167 3300044712 Bacteria 6931
114 Ga0453684_0077410 3300044712 Bacteria 4169
115 Ga0453684_0121357 3300044712 Bacteria 3155
116 Ga0453684_0200054 3300044712 Bacteria 2330
117 Ga0453684_0265964 3300044712 Bacteria 1962
118 Ga0453684_0303723 3300044712 Bacteria 1813
119 Ga0453684_0390639 3300044712 Bacteria 1560
120 Ga0453684_0438921 3300044712 Bacteria 1455
121 Ga0453684_0624783 3300044712 Bacteria 1178
122 Ga0453684_0750141 3300044712 Bacteria 1057
123 Ga0453684_1023793 3300044712 Bacteria 877
124 Ga0453684_1040700 3300044712 Unclassified 868
125 Ga0453684_1490252 3300044712 Bacteria 698
126 Ga0453684_1707202 3300044712 Unclassified 643
127 Ga0451576_0003500 3300045051 Bacteria 21465
128 Ga0451576_0126404 3300045051 Bacteria 2664
129 Ga0451576_1672271 3300045051 Bacteria 660
130 Ga0496108_0230700 3300048911 Bacteria 1610
131 Ga0496125_0001152 3300048928 Bacteria 40077
132 nmdc:mga05p37_1325845_c1 3300050507 Bacteria 731
133 nmdc:mga05p37_189427_c1 3300050507 Bacteria 2498
134 nmdc:mga05p37_259042_c1 3300050507 Bacteria 2083
135 nmdc:mga05p37_461_c1 3300050507 Bacteria 44218
136 nmdc:mga05p37_484935_c1 3300050507 Bacteria 1423
137 nmdc:mga05p37_57194_c1 3300050507 Bacteria 4803
138 nmdc:mga09592_2481_c1 3300050508 Bacteria 5424
139 nmdc:mga09592_334621_c1 3300050508 Bacteria 1311
140 nmdc:mga09592_443184_c1 3300050508 Bacteria 1121
141 nmdc:mga09592_840246_c1 3300050508 Bacteria 775
142 nmdc:mga09592_94791_c1 3300050508 Bacteria 2553
143 nmdc:mga0qj67_1371102_c1 3300050509 Unclassified 546
144 nmdc:mga0qj67_499997_c1 3300050509 Bacteria 977
145 nmdc:mga06r32_1283434_c1 3300050510 Bacteria 677
146 nmdc:mga0n895_111712_c1 3300050512 Bacteria 2749
147 nmdc:mga0a205_355662_c1 3300050515 Unclassified 1331
148 nmdc:mga0a205_750115_c1 3300050515 Bacteria 825
149 Ga0453684_0548469
150 SwRhRL2b_contig_3027227
151 JGI25406J46586_10005654
152 JGI25406J46586_10007837
153 Ga0065707_10082025
154 Ga0065707_10224487
155 Ga0065707_10439692
156 Ga0070669_101745044
157 Ga0070705_100180662
158 Ga0070694_100545997
159 Ga0070706_101708770
160 Ga0070706_101965998
161 Ga0070707_100150767
162 Ga0070698_100080814
163 Ga0070698_100201920
164 Ga0070699_100036881
165 Ga0070699_100269113
166 Ga0070699_100584892
167 Ga0070699_101302051
168 Ga0070695_100626485
169 Ga0070696_100954337
170 Ga0070696_101358768
171 Ga0070704_100098666
172 Ga0070704_101112609
173 Ga0068857_100510667
174 Ga0068857_100982755
175 Ga0070702_101280694
176 Ga0068866_10521874
177 Ga0068861_100555538
178 Ga0068860_100149511
179 Ga0068862_100075679
180 Ga0068862_101674143
181 Ga0081539_10002731
182 Ga0075428_100039020
183 Ga0075428_100598780
184 Ga0075428_100744959
185 Ga0075430_100109387
186 Ga0075430_100519415
187 Ga0075431_101373228
188 Ga0075431_101737545
189 Ga0075433_10321073
190 Ga0075433_10641299
191 Ga0075434_100760412
192 Ga0075429_100031423
193 Ga0075429_100106695
194 Ga0075429_100124661
195 Ga0075429_100612906
196 Ga0075429_100622545
197 Ga0075429_101106100
198 Ga0105245_10456799
199 Ga0114129_10025283
200 Ga0114129_10033436
201 Ga0114129_10036108
202 Ga0114129_10435807
203 Ga0114129_11202154
204 Ga0105243_10143495
205 Ga0105243_10787806
206 Ga0105243_12315361
207 Ga0105241_12108198
208 Ga0105242_10644046
209 Ga0105246_10039413
210 Ga0157380_11267273
211 Ga0157379_11620811
212 Ga0207684_11476093
213 Ga0207646_10063871
214 Ga0207709_10086844
215 Ga0207712_10182916
216 Ga0207674_10172573
217 Ga0207674_10649315
218 Ga0209981_1022951
219 Ga0209968_1003905
220 Ga0268265_10178346
221 Ga0268264_10678317
222 Ga0268264_12254261
223 Ga0265323_10011432
224 Ga0265323_10123921
225 Ga0307408_101472462
226 Ga0316575_10340886
227 Ga0316576_10576961
228 Ga0316578_10038798
229 Ga0316578_10286060
230 Ga0316578_10651051
231 Ga0316577_10675936
232 Ga0307416_100611684
233 Ga0307416_101576679
234 Ga0307411_10503218
235 Ga0316574_0447160
236 Ga0316574_0591959
237 Ga0316584_0172573
238 Ga0316584_0515252
239 Ga0373925_0368376
240 Ga0400483_051997
241 Ga0451800_0679400
242 Ga0451577_0004778
243 Ga0451577_0016145
244 Ga0451577_0340182
245 Ga0451577_0546284
246 Ga0453683_0014146
247 Ga0453683_0073749
248 Ga0453683_0093770
249 Ga0453683_0192466
250 Ga0453683_0362949
251 Ga0453683_0363203
252 Ga0453684_0000035
253 Ga0453684_0000232
254 Ga0453684_0000588
255 Ga0453684_0000658
256 Ga0453684_0001420
257 Ga0453684_0002913
258 Ga0453684_0003088
259 Ga0453684_0012243
260 Ga0453684_0021394
261 Ga0453684_0035167
262 Ga0453684_0077410
263 Ga0453684_0121357
264 Ga0453684_0200054
265 Ga0453684_0265964
266 Ga0453684_0303723
267 Ga0453684_0390639
268 Ga0453684_0438921
269 Ga0453684_0624783
270 Ga0453684_0750141
271 Ga0453684_1023793
272 Ga0453684_1040700
273 Ga0453684_1490252
274 Ga0453684_1707202
275 Ga0451576_0003500
276 Ga0451576_0126404
277 Ga0451576_1672271
278 Ga0496108_0230700
279 Ga0496125_0001152
280 nmdc:mga05p37_1325845_c1
281 nmdc:mga05p37_189427_c1
282 nmdc:mga05p37_259042_c1
283 nmdc:mga05p37_461_c1
284 nmdc:mga05p37_484935_c1
285 nmdc:mga05p37_57194_c1
286 nmdc:mga09592_2481_c1
287 nmdc:mga09592_334621_c1
288 nmdc:mga09592_443184_c1
289 nmdc:mga09592_840246_c1
290 nmdc:mga09592_94791_c1
291 nmdc:mga0qj67_1371102_c1
292 nmdc:mga0qj67_499997_c1
293 nmdc:mga06r32_1283434_c1
294 nmdc:mga0n895_111712_c1
295 nmdc:mga0a205_355662_c1
296 nmdc:mga0a205_750115_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00376

MerR

MerR family regulatory protein

19

56

0.98

PF09278

MerR-DNA-bind

MerR, DNA binding

61

125

0.97

PF13411

MerR_1

MerR HTH family regulatory protein

18

87

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5d8c-assembly1.cif.gz_A crystal structure of hinmlr, a merr family regulator lacking the sensor domain, bound to promoter dna 0.9275 2 115
5d90-assembly2.cif.gz_C crystal structure of hinmlr, a merr family regulator lacking the sensor domain, bound to promoter dna 0.9137 1 115
7tec-assembly1.cif.gz_A-2 structure of the listeria monocytogenes glnr-dna complex to 3.45 angstrom 0.9095 1 61
3gp4-assembly1.cif.gz_A crystal structure of putative merr family transcriptional regulator from listeria monocytogenes 0.9083 1 129
3gpv-assembly1.cif.gz_A crystal structure of a transcriptional regulator, merr family from bacillus thuringiensis 0.9078 1 109
ID Description Score Start End Superfamily
3gp4B00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9463 1 113 1.10.1660.10
5d8cA00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9275 2 115 1.10.1660.10
5d90C00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9156 1 115 1.10.1660.10
af_Q2FW56_1_134_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9129 1 118 1.10.1660.10
3gpvB00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9119 2 113 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A2T0VTG6-F1-model_v4 DNA-binding transcriptional MerR regulator 0.9897 1 123 GO:0003677
GO:0003700
AF-A0A7W0FJN3-F1-model_v4 MerR family transcriptional regulator 0.9883 1 113 GO:0003677
GO:0003700
AF-A0A7X8FV60-F1-model_v4 MerR family transcriptional regulator 0.9883 1 121 GO:0003677
GO:0003700
AF-A0A0R1ZKE5-F1-model_v4 HTH merR-type domain-containing protein 0.9873 1 114 GO:0003677
GO:0003700
AF-A0A348AN50-F1-model_v4 HTH-type transcriptional regulator AdhR 0.9867 1 110 GO:0003677
GO:0003700

Map