F203604

General Info

Members Datasets Scaffolds Average Seq Length
148 108 296 187

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10228560|Ga0307513_102285601
Length 214
Sequence VDALGRLRLDLAGCGAPRYIPGMATPSTMLELGTPVPDFSLVDVRTGETVSLADFADARGLLVMFICNHCPFVKHVRGELAALGRDYDGKGLAIVAINSNDATTHPQDGPPYMKAEAAAQGYGFPYLFDERQEVAKAFRAACTPDFYVFDRDRRLAYRGQLDGSRPGNRVPVTGADLRAACDAVLDGASPAAAQTASVGCNIKWRAGNAPDYYG

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
56 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
57 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
58 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
59 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
62 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
63 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
64 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
65 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
66 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
67 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
70 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
71 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
72 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
77 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
78 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
85 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
89 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
90 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
91 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
92 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
93 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
94 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
95 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
96 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
97 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
98 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
99 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
100 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
101 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
102 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
103 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
104 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
105 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
106 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
107 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
108 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.3
Metatranscriptomes 1.35
Isolates 1.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.19
Nodule 0
Rhizoplane 0
Rhizosphere 81.08
Stem 0
Stem Tuber 0
Unclassified 12.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10228560 3300031456 Bacteria 1675
2 JGI24751J29686_10000522 3300002459 Bacteria 11004
3 Ga0065704_10014243 3300005289 Bacteria 1830
4 Ga0065715_10169953 3300005293 Bacteria 1551
5 Ga0070670_100023292 3300005331 Bacteria 5330
6 Ga0070666_10569037 3300005335 Bacteria 825
7 Ga0070680_100671350 3300005336 Bacteria 891
8 Ga0070691_10173588 3300005341 Bacteria 1118
9 Ga0070687_100036305 3300005343 Bacteria 2455
10 Ga0070687_100878666 3300005343 Bacteria 641
11 Ga0070669_100601890 3300005353 Bacteria 921
12 Ga0070675_100095591 3300005354 Bacteria 2495
13 Ga0070673_100087420 3300005364 Bacteria 2540
14 Ga0070714_101084482 3300005435 Unclassified 780
15 Ga0070694_100517607 3300005444 Bacteria 951
16 Ga0068853_100025217 3300005539 Bacteria 4989
17 Ga0068859_100080724 3300005617 Bacteria 3294
18 Ga0068861_100003102 3300005719 Bacteria 10985
19 Ga0068863_101587252 3300005841 Bacteria 663
20 Ga0068858_100008631 3300005842 Bacteria 9788
21 Ga0075365_10000345 3300006038 Bacteria 16599
22 Ga0075365_10095515 3300006038 Bacteria 2030
23 Ga0075365_10108092 3300006038 Eukaryota 1910
24 Ga0075363_100005620 3300006048 Eukaryota 5603
25 Ga0075364_10001517 3300006051 Bacteria 12638
26 Ga0070716_100349205 3300006173 Eukaryota 1046
27 Ga0075367_10120836 3300006178 Bacteria 1614
28 Ga0075369_10011842 3300006186 Eukaryota 3436
29 Ga0075427_10006602 3300006194 Bacteria 1686
30 Ga0075366_10111967 3300006195 Unclassified 1642
31 Ga0097621_100367771 3300006237 Bacteria 1282
32 Ga0075370_10000554 3300006353 Bacteria 14331
33 Ga0075428_100006607 3300006844 Bacteria 12900
34 Ga0075434_100078357 3300006871 Eukaryota 3300
35 Ga0075429_100000136 3300006880 Bacteria 44169
36 Ga0075429_100009830 3300006880 Bacteria 8296
37 Ga0097620_100080725 3300006931 Bacteria 3294
38 Ga0111539_10097315 3300009094 Bacteria 3457
39 Ga0111539_10144255 3300009094 Unclassified 2787
40 Ga0111539_10991773 3300009094 Unclassified 977
41 Ga0114129_10274291 3300009147 Eukaryota 2255
42 Ga0114129_11146767 3300009147 Bacteria 971
43 Ga0105249_10000805 3300009553 Bacteria 28223
44 Ga0163162_10016937 3300013306 Bacteria 7128
45 Ga0163162_10188342 3300013306 Unclassified 2191
46 Ga0157380_10144376 3300014326 Bacteria 2049
47 Ga0157377_10114078 3300014745 Bacteria 1628
48 Ga0157376_10130823 3300014969 Bacteria 2239
49 Ga0213876_10085666 3300021384 Bacteria 1667
50 Ga0209256_1022928 3300025299 Bacteria 1877
51 Ga0207656_10000318 3300025321 Bacteria 16561
52 Ga0207643_10055188 3300025908 Bacteria 2259
53 Ga0207662_10037809 3300025918 Bacteria 2827
54 Ga0207662_10833797 3300025918 Bacteria 651
55 Ga0207650_10023722 3300025925 Bacteria 4356
56 Ga0207686_10087654 3300025934 Bacteria 2048
57 Ga0207667_10423157 3300025949 Bacteria 1355
58 Ga0207651_10056649 3300025960 Bacteria 2699
59 Ga0207651_10172053 3300025960 Bacteria 1709
60 Ga0207712_10004929 3300025961 Bacteria 8437
61 Ga0207703_10066636 3300026035 Bacteria 2962
62 Ga0207639_10010265 3300026041 Bacteria 6482
63 Ga0207641_11531653 3300026088 Bacteria 668
64 Ga0207675_100011581 3300026118 Bacteria 8247
65 Ga0265334_10000034 3300028573 Bacteria 105710
66 Ga0265334_10003394 3300028573 Bacteria 7261
67 Ga0265334_10074259 3300028573 Bacteria 1262
68 Ga0265322_10039801 3300028654 Bacteria 1338
69 Ga0265325_10147518 3300031241 Unclassified 1115
70 Ga0265329_10057556 3300031242 Unclassified 1232
71 Ga0265331_10098312 3300031250 Unclassified 1349
72 Ga0265316_10129748 3300031344 Unclassified 1899
73 Ga0265313_10004453 3300031595 Bacteria 10757
74 Ga0265313_10162486 3300031595 Bacteria 948
75 Ga0316575_10099368 3300031665 Bacteria 1182
76 Ga0316575_10109078 3300031665 Bacteria 1129
77 Ga0316579_10143969 3300031691 Unclassified 1149
78 Ga0316578_10174805 3300031728 Bacteria 1294
79 Ga0316577_10034126 3300031733 Unclassified 2843
80 Ga0316577_10153977 3300031733 Bacteria 1296
81 Ga0316583_10074362 3300032133 Bacteria 1188
82 Ga0316588_1023176 3300033528 Bacteria 1423
83 Ga0316596_1083685 3300033541 Unclassified 858
84 Ga0373961_0252083 3300035241 Bacteria 639
85 Ga0316574_0003768 3300035398 Bacteria 7855
86 Ga0316574_0120178 3300035398 Bacteria 1687
87 Ga0316574_0146466 3300035398 Bacteria 1522
88 Ga0373931_0113394 3300035691 Bacteria 1541
89 Ga0316584_0013785 3300036712 Bacteria 5732
90 Ga0316584_0052353 3300036712 Bacteria 3053
91 Ga0316584_0403431 3300036712 Unclassified 973
92 Ga0395900_0216218 3300037418 Bacteria 1934
93 Ga0395900_0280573 3300037418 Bacteria 1658
94 Ga0395898_0770522 3300037466 Bacteria 903
95 Ga0395905_1027175 3300037471 Bacteria 727
96 Ga0436365_0301729 3300039437 Bacteria 1608
97 Ga0436363_1422181 3300039450 Bacteria 1399
98 Ga0451837_1507276 3300041494 Unclassified 2616
99 Ga0451577_0437677 3300042876 Unclassified 1187
100 Ga0453683_0502728 3300044673 Bacteria 786
101 Ga0453684_0012127 3300044712 Bacteria 14303
102 Ga0453684_0030351 3300044712 Bacteria 7637
103 Ga0451576_0000635 3300045051 Bacteria 73052
104 Ga0451576_0001510 3300045051 Bacteria 39222
105 Ga0451576_0007066 3300045051 Bacteria 13563
106 Ga0451576_0008743 3300045051 Bacteria 11849
107 Ga0451576_0071201 3300045051 Bacteria 3618
108 Ga0451576_0618999 3300045051 Bacteria 1138
109 Ga0466967_0324244 3300045976 Bacteria 1486
110 Ga0495614_0318183 3300048089 Bacteria 721
111 Ga0496117_0000222 3300048920 Bacteria 107624
112 Ga0501034_0465770 3300049571 Bacteria 1180
113 Ga0501034_0849274 3300049571 Bacteria 803
114 Ga0501047_0026885 3300049581 Bacteria 5540
115 Ga0501047_0042269 3300049581 Bacteria 4405
116 Ga0501047_0078216 3300049581 Bacteria 3181
117 Ga0501070_0000751 3300049586 Bacteria 29606
118 Ga0501073_0452775 3300049589 Bacteria 887
119 Ga0501217_162097 3300049661 Bacteria 675
120 Ga0501080_0695329 3300049742 Bacteria 897
121 Ga0501083_0085471 3300049744 Bacteria 2087
122 Ga0501083_0131318 3300049744 Bacteria 1642
123 Ga0501083_0136973 3300049744 Bacteria 1604
124 Ga0501083_0621071 3300049744 Bacteria 703
125 Ga0501044_0225119 3300049823 Bacteria 1825
126 Ga0501044_0328742 3300049823 Bacteria 1452
127 nmdc:mga03n38_93776_c1 3300050490 Bacteria 1435
128 nmdc:mga00v17_8719_c1 3300050491 Bacteria 5461
129 nmdc:mga0yw44_246_c1 3300050492 Bacteria 18447
130 nmdc:mga0yw44_90201_c1 3300050492 Eukaryota 1936
131 nmdc:mga0k408_212555_c1 3300050493 Unclassified 1155
132 nmdc:mga0k408_440508_c1 3300050493 Bacteria 774
133 nmdc:mga06z11_366051_c1 3300050494 Eukaryota 865
134 nmdc:mga07m45_125_c1 3300050496 Bacteria 30481
135 nmdc:mga05p37_40166_c2 3300050507 Bacteria 4549
136 nmdc:mga05p37_893336_c1 3300050507 Bacteria 959
137 nmdc:mga09592_472106_c1 3300050508 Bacteria 1081
138 nmdc:mga09592_73822_c1 3300050508 Bacteria 2899
139 nmdc:mga09592_8490_c1 3300050508 Bacteria 8354
140 nmdc:mga06r32_448294_c1 3300050510 Bacteria 1270
141 nmdc:mga08y16_352091_c1 3300050511 Unclassified 1512
142 nmdc:mga08y16_744046_c1 3300050511 Unclassified 977
143 nmdc:mga0n895_82680_c1 3300050512 Eukaryota 3201
144 nmdc:mga0sz30_21_c2 3300050516 Bacteria 37875
145 nmdc:mga0sz30_271088_c1 3300050516 Bacteria 756
146 Ga0500643_108187 3300053087 Unclassified 752
147 2735816016 2734482258 Unclassified 2930739
148 2833640264 2833640130 Bacteria 4858325
149 Ga0307513_10228560
150 JGI24751J29686_10000522
151 Ga0065704_10014243
152 Ga0065715_10169953
153 Ga0070670_100023292
154 Ga0070666_10569037
155 Ga0070680_100671350
156 Ga0070691_10173588
157 Ga0070687_100036305
158 Ga0070687_100878666
159 Ga0070669_100601890
160 Ga0070675_100095591
161 Ga0070673_100087420
162 Ga0070714_101084482
163 Ga0070694_100517607
164 Ga0068853_100025217
165 Ga0068859_100080724
166 Ga0068861_100003102
167 Ga0068863_101587252
168 Ga0068858_100008631
169 Ga0075365_10000345
170 Ga0075365_10095515
171 Ga0075365_10108092
172 Ga0075363_100005620
173 Ga0075364_10001517
174 Ga0070716_100349205
175 Ga0075367_10120836
176 Ga0075369_10011842
177 Ga0075427_10006602
178 Ga0075366_10111967
179 Ga0097621_100367771
180 Ga0075370_10000554
181 Ga0075428_100006607
182 Ga0075434_100078357
183 Ga0075429_100000136
184 Ga0075429_100009830
185 Ga0097620_100080725
186 Ga0111539_10097315
187 Ga0111539_10144255
188 Ga0111539_10991773
189 Ga0114129_10274291
190 Ga0114129_11146767
191 Ga0105249_10000805
192 Ga0163162_10016937
193 Ga0163162_10188342
194 Ga0157380_10144376
195 Ga0157377_10114078
196 Ga0157376_10130823
197 Ga0213876_10085666
198 Ga0209256_1022928
199 Ga0207656_10000318
200 Ga0207643_10055188
201 Ga0207662_10037809
202 Ga0207662_10833797
203 Ga0207650_10023722
204 Ga0207686_10087654
205 Ga0207667_10423157
206 Ga0207651_10056649
207 Ga0207651_10172053
208 Ga0207712_10004929
209 Ga0207703_10066636
210 Ga0207639_10010265
211 Ga0207641_11531653
212 Ga0207675_100011581
213 Ga0265334_10000034
214 Ga0265334_10003394
215 Ga0265334_10074259
216 Ga0265322_10039801
217 Ga0265325_10147518
218 Ga0265329_10057556
219 Ga0265331_10098312
220 Ga0265316_10129748
221 Ga0265313_10004453
222 Ga0265313_10162486
223 Ga0316575_10099368
224 Ga0316575_10109078
225 Ga0316579_10143969
226 Ga0316578_10174805
227 Ga0316577_10034126
228 Ga0316577_10153977
229 Ga0316583_10074362
230 Ga0316588_1023176
231 Ga0316596_1083685
232 Ga0373961_0252083
233 Ga0316574_0003768
234 Ga0316574_0120178
235 Ga0316574_0146466
236 Ga0373931_0113394
237 Ga0316584_0013785
238 Ga0316584_0052353
239 Ga0316584_0403431
240 Ga0395900_0216218
241 Ga0395900_0280573
242 Ga0395898_0770522
243 Ga0395905_1027175
244 Ga0436365_0301729
245 Ga0436363_1422181
246 Ga0451837_1507276
247 Ga0451577_0437677
248 Ga0453683_0502728
249 Ga0453684_0012127
250 Ga0453684_0030351
251 Ga0451576_0000635
252 Ga0451576_0001510
253 Ga0451576_0007066
254 Ga0451576_0008743
255 Ga0451576_0071201
256 Ga0451576_0618999
257 Ga0466967_0324244
258 Ga0495614_0318183
259 Ga0496117_0000222
260 Ga0501034_0465770
261 Ga0501034_0849274
262 Ga0501047_0026885
263 Ga0501047_0042269
264 Ga0501047_0078216
265 Ga0501070_0000751
266 Ga0501073_0452775
267 Ga0501217_162097
268 Ga0501080_0695329
269 Ga0501083_0085471
270 Ga0501083_0131318
271 Ga0501083_0136973
272 Ga0501083_0621071
273 Ga0501044_0225119
274 Ga0501044_0328742
275 nmdc:mga03n38_93776_c1
276 nmdc:mga00v17_8719_c1
277 nmdc:mga0yw44_246_c1
278 nmdc:mga0yw44_90201_c1
279 nmdc:mga0k408_212555_c1
280 nmdc:mga0k408_440508_c1
281 nmdc:mga06z11_366051_c1
282 nmdc:mga07m45_125_c1
283 nmdc:mga05p37_40166_c2
284 nmdc:mga05p37_893336_c1
285 nmdc:mga09592_472106_c1
286 nmdc:mga09592_73822_c1
287 nmdc:mga09592_8490_c1
288 nmdc:mga06r32_448294_c1
289 nmdc:mga08y16_352091_c1
290 nmdc:mga08y16_744046_c1
291 nmdc:mga0n895_82680_c1
292 nmdc:mga0sz30_21_c2
293 nmdc:mga0sz30_271088_c1
294 Ga0500643_108187
295 2735816016
296 2833640264

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

32

158

0.93

PF08534

Redoxin

Redoxin

31

177

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ywi-assembly2.cif.gz_B crystal structure of uncharacterized conserved protein from geobacillus kaustophilus 0.9899 1 187
3u5r-assembly1.cif.gz_E crystal structure of a hypothetical protein smc02350 from sinorhizobium meliloti 1021 0.9856 4 184
2ywi-assembly2.cif.gz_B crystal structure of uncharacterized conserved protein from geobacillus kaustophilus 0.9847 1 187
3u5r-assembly1.cif.gz_E crystal structure of a hypothetical protein smc02350 from sinorhizobium meliloti 1021 0.9644 4 184
2cvb-assembly1.cif.gz_A crystal structure of a thioredoxin-like protein from thermus thermophilus hb8 0.929 9 184
ID Description Score Start End Superfamily
af_P71990_1_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9859 2 184 3.40.30.10
af_I1KAL3_50_244_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9814 2 184 3.40.30.10
af_P71990_1_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9805 2 184 3.40.30.10
af_I1KAL3_50_244_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9555 2 184 3.40.30.10
2ywoA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9386 9 184 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2N6N7B6-F1-model_v4 Alkyl hydroperoxide reductase and/or thiol-specific antioxidant family (AhpC/TSA) protein 1 60 185 GO:0016209
GO:0016491
AF-A0A2G1Z9N8-F1-model_v4 Thioredoxin family protein 0.9999 1 149 GO:0016209
GO:0016491
AF-A0A1G6ZN64-F1-model_v4 AhpC/TSA family protein 0.9999 44 185 GO:0016209
GO:0016491
AF-A0A1Z4EJ21-F1-model_v4 Thioredoxin family protein 0.999 74 184 GO:0016209
GO:0016491
AF-A0A5B7X774-F1-model_v4 Thioredoxin family protein 0.9984 1 187 GO:0016209
GO:0016491

Map