F203328

General Info

Members Datasets Scaffolds Average Seq Length
148 119 296 258

Family's Representative Sequence

Representative Sequence 3300025898|Ga0207692_10100873|Ga0207692_101008732
Length 300
Sequence VAELDAFLALASDLADAAGAAIRPHFRQRIAVDDKADLSPVTIADRNAEAAMRRLIAARFPDHGIIGEEYGAQRETAEFVWVLDPIDGTKSFISGVPLFGTLVALAHHGRPILGIIDQPISRERWIGASGRPTTLNGSAVHCRPCPKLAAATLFSTSPDMFKGADAAAQARVAAKAKLVRYGADCYAYGLVALGLIDLVIEASLKPYDFSAMAPIVEGAGGIATDWQGQKLSLASDGRVVVAGDPHVHSPGVTKKMREQAFSGQGRLRLRRDLLVFVEPGLEAVAGQLPDGPPAGGEQRV

Samples

Sample ID Description Type Environment
1 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
21 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
22 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
23 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
24 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
25 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
26 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
27 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
28 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
29 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
30 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
31 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
32 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
33 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
45 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
46 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
47 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
48 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
49 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
50 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
51 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
52 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
53 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
54 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
55 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
56 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
57 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
58 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
59 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
60 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
63 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
67 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
70 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
71 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
72 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
75 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
76 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
77 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
78 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
79 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
80 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
81 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
82 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
83 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
84 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
85 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
86 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
87 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
88 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
89 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
90 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
93 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
94 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
95 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
97 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
98 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
99 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
100 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
101 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
102 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
103 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
104 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
105 2643221557 Ensifer sp. Root558 Isolate Unclassified
106 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
107 2643221610 Ensifer sp. Root74 Isolate Unclassified
108 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
109 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
110 2643221668 Ensifer sp. Root423 Isolate Unclassified
111 2643221675 Ensifer sp. Root1298 Isolate Unclassified
112 2643221680 Ensifer sp. Root1312 Isolate Unclassified
113 2643221718 Rhizobium sp. Root268 Isolate Unclassified
114 2643221726 Ensifer sp. Root954 Isolate Unclassified
115 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
116 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
117 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
118 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
119 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.86
Metatranscriptomes 0
Isolates 10.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.03
Nodule 2.7
Rhizoplane 2.03
Rhizosphere 77.7
Stem 0
Stem Tuber 0
Unclassified 1.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207692_10100873 3300025898 Bacteria 1584
2 Ga0055524_1000708 3300003775 Bacteria 23047
3 Ga0070660_100043501 3300005339 Bacteria 3432
4 Ga0070668_100030680 3300005347 Bacteria 4089
5 Ga0070671_100549341 3300005355 Bacteria 996
6 Ga0070709_10008936 3300005434 Bacteria 5515
7 Ga0070709_10032063 3300005434 Bacteria 3166
8 Ga0070714_100024597 3300005435 Bacteria 4962
9 Ga0070714_100279196 3300005435 Bacteria 1551
10 Ga0070714_100302133 3300005435 Bacteria 1492
11 Ga0070713_100003126 3300005436 Bacteria 10898
12 Ga0070711_100010035 3300005439 Bacteria 5846
13 Ga0070708_100304946 3300005445 Bacteria 1500
14 Ga0070681_10427742 3300005458 Bacteria 1236
15 Ga0070707_100037641 3300005468 Bacteria 4618
16 Ga0070698_100005644 3300005471 Bacteria 13697
17 Ga0070698_100288352 3300005471 Unclassified 1573
18 Ga0070686_100221680 3300005544 Bacteria 1367
19 Ga0081540_1004333 3300005983 Bacteria 10871
20 Ga0070717_10007184 3300006028 Bacteria 8254
21 Ga0070717_10137125 3300006028 Bacteria 2108
22 Ga0070712_100150383 3300006175 Bacteria 1787
23 Ga0075434_100533589 3300006871 Bacteria 1194
24 Ga0111539_10139571 3300009094 Bacteria 2838
25 Ga0099796_10106706 3300010159 Bacteria 1061
26 Ga0163162_10158655 3300013306 Bacteria 2383
27 Ga0157380_10509678 3300014326 Bacteria 1171
28 Ga0182008_10070480 3300014497 Bacteria 1720
29 Ga0157379_10160002 3300014968 Bacteria 2033
30 Ga0157376_10086144 3300014969 Bacteria 2708
31 Ga0214544_1000029 3300021320 Bacteria 153924
32 Ga0214542_1000092 3300021321 Bacteria 117288
33 Ga0214543_1000045 3300021327 Bacteria 152699
34 Ga0213873_10034411 3300021358 Bacteria 1277
35 Ga0213872_10059535 3300021361 Bacteria 1728
36 Ga0213876_10062602 3300021384 Bacteria 1964
37 Ga0213875_10001127 3300021388 Bacteria 18428
38 Ga0213875_10161317 3300021388 Bacteria 1051
39 Ga0209256_1000286 3300025299 Bacteria 88880
40 Ga0207692_10042228 3300025898 Bacteria 2262
41 Ga0207699_10008286 3300025906 Bacteria 5121
42 Ga0207699_10078421 3300025906 Bacteria 2040
43 Ga0207707_10335970 3300025912 Bacteria 1303
44 Ga0207693_10002822 3300025915 Bacteria 15058
45 Ga0207693_10138912 3300025915 Bacteria 1911
46 Ga0207693_10274931 3300025915 Bacteria 1320
47 Ga0207646_10026494 3300025922 Bacteria 5289
48 Ga0207650_10517562 3300025925 Bacteria 998
49 Ga0207700_10003148 3300025928 Bacteria 9523
50 Ga0207700_10178233 3300025928 Bacteria 1778
51 Ga0207700_10572268 3300025928 Bacteria 1004
52 Ga0207664_10062730 3300025929 Bacteria 2969
53 Ga0207664_10428939 3300025929 Bacteria 1178
54 Ga0207668_10041222 3300025972 Bacteria 3120
55 Ga0207678_10155737 3300026067 Bacteria 1951
56 Ga0268266_10263880 3300028379 Bacteria 1597
57 Ga0265327_10074510 3300031251 Bacteria 1690
58 Ga0307408_100004861 3300031548 Bacteria 9050
59 Ga0307408_100085236 3300031548 Bacteria 2372
60 Ga0316578_10111172 3300031728 Bacteria 1646
61 Ga0307410_10104290 3300031852 Bacteria 2038
62 Ga0307409_100752296 3300031995 Bacteria 978
63 Ga0307416_100061038 3300032002 Bacteria 3074
64 Ga0307414_10004614 3300032004 Bacteria 7494
65 Ga0307414_10027055 3300032004 Bacteria 3700
66 Ga0307411_10044604 3300032005 Bacteria 2846
67 Ga0373934_0107761 3300035086 Bacteria 1129
68 Ga0373936_0074690 3300035113 Bacteria 1403
69 Ga0373957_0006077 3300035120 Bacteria 3783
70 Ga0373943_0187396 3300035170 Bacteria 1140
71 Ga0373955_0013695 3300035172 Bacteria 3930
72 Ga0373961_0060025 3300035241 Bacteria 1151
73 Ga0373931_0340928 3300035691 Bacteria 936
74 Ga0373933_0015695 3300035724 Bacteria 4225
75 Ga0373947_0161731 3300035725 Bacteria 1448
76 Ga0373937_0032275 3300036401 Bacteria 4749
77 Ga0373937_0056185 3300036401 Bacteria 3614
78 Ga0373937_0096278 3300036401 Bacteria 2745
79 Ga0316584_0057443 3300036712 Bacteria 2913
80 Ga0316584_0190559 3300036712 Bacteria 1516
81 Ga0373925_0062384 3300037068 Bacteria 2803
82 Ga0395900_0247319 3300037418 Bacteria 1786
83 Ga0395898_0801585 3300037466 Bacteria 882
84 Ga0436364_0022735 3300037853 Bacteria 162985
85 Ga0436364_0082987 3300037853 Bacteria 54429
86 Ga0436364_0764984 3300037853 Bacteria 1641
87 Ga0400483_138466 3300039062 Bacteria 2028
88 Ga0436365_0352243 3300039437 Bacteria 2402
89 Ga0436365_0680443 3300039437 Bacteria 1332
90 Ga0436361_0070611 3300039447 Bacteria 6508
91 Ga0436361_0455164 3300039447 Unclassified 993
92 Ga0436361_0746172 3300039447 Bacteria 1502
93 Ga0436361_0827335 3300039447 Bacteria 1037
94 Ga0436361_1057931 3300039447 Bacteria 1073
95 Ga0436363_1295837 3300039450 Bacteria 2720
96 Ga0436362_0610463 3300039453 Bacteria 5809
97 Ga0436362_0921965 3300039453 Bacteria 1198
98 Ga0439431_0024749 3300041997 Bacteria 1463
99 Ga0451576_0004319 3300045051 Bacteria 18565
100 Ga0495592_0069804 3300046454 Bacteria 2561
101 Ga0495638_0046777 3300046460 Bacteria 2717
102 Ga0495580_0094951 3300046472 Bacteria 2074
103 Ga0495628_0107049 3300046516 Bacteria 2153
104 Ga0495640_0117659 3300046533 Bacteria 1730
105 Ga0495586_0023638 3300046535 Bacteria 3283
106 Ga0495667_0031228 3300046559 Bacteria 3576
107 Ga0495667_0057202 3300046559 Bacteria 2564
108 Ga0495634_0064734 3300046642 Bacteria 2423
109 Ga0495599_0063298 3300046678 Bacteria 2311
110 Ga0495600_0021186 3300046809 Bacteria 4162
111 Ga0495604_0090070 3300047317 Bacteria 2279
112 Ga0495680_0151703 3300047322 Bacteria 1689
113 Ga0495680_0303000 3300047322 Bacteria 1122
114 Ga0496110_0788588 3300048913 Bacteria 854
115 Ga0496111_0479127 3300048914 Bacteria 917
116 Ga0496113_0117204 3300048916 Bacteria 2079
117 Ga0496120_0125436 3300048923 Bacteria 1322
118 Ga0501039_0232653 3300049575 Bacteria 1449
119 Ga0501041_0093478 3300049577 Bacteria 1857
120 Ga0501071_0044171 3300049587 Bacteria 3196
121 Ga0501072_0095776 3300049588 Bacteria 2359
122 Ga0501081_0500392 3300049743 Bacteria 905
123 Ga0501035_0471632 3300049822 Bacteria 1036
124 Ga0501044_0136403 3300049823 Bacteria 2445
125 nmdc:mga08y16_170501_c1 3300050511 Bacteria 2260
126 nmdc:mga0rr50_148994_c1 3300050513 Bacteria 1889
127 nmdc:mga08x19_51612_c1 3300050514 Bacteria 2643
128 Ga0495601_0009841 3300053077 Bacteria 5658
129 Ga0495595_0004996 3300053084 Bacteria 5357
130 Ga0495595_0110763 3300053084 Bacteria 1331
131 Ga0495619_0016494 3300053085 Bacteria 4677
132 Ga0500616_0074987 3300053153 Bacteria 1713
133 Ga0501082_0236503 3300060353 Bacteria 1590
134 2643807884 2643221557 Bacteria 7184309
135 2643950967 2643221588 Bacteria 3692460
136 2644068036 2643221610 Bacteria 7480339
137 2644129501 2643221623 Bacteria 5239945
138 2644207570 2643221637 Bacteria 5345260
139 2644378225 2643221668 Bacteria 7306521
140 2644418899 2643221675 Bacteria 7473456
141 2644452326 2643221680 Bacteria 7473610
142 2644651319 2643221718 Bacteria 5345506
143 2644687070 2643221726 Bacteria 7455827
144 2883355323 2883354860 Bacteria 5865246
145 2919681799 2919679072 Bacteria 4629602
146 2941503053 2941499720 Bacteria 7599444
147 8002290006 8002285264 Bacteria 6717907
148 8054568299 8054563764 Bacteria 5592885
149 Ga0207692_10100873
150 Ga0055524_1000708
151 Ga0070660_100043501
152 Ga0070668_100030680
153 Ga0070671_100549341
154 Ga0070709_10008936
155 Ga0070709_10032063
156 Ga0070714_100024597
157 Ga0070714_100279196
158 Ga0070714_100302133
159 Ga0070713_100003126
160 Ga0070711_100010035
161 Ga0070708_100304946
162 Ga0070681_10427742
163 Ga0070707_100037641
164 Ga0070698_100005644
165 Ga0070698_100288352
166 Ga0070686_100221680
167 Ga0081540_1004333
168 Ga0070717_10007184
169 Ga0070717_10137125
170 Ga0070712_100150383
171 Ga0075434_100533589
172 Ga0111539_10139571
173 Ga0099796_10106706
174 Ga0163162_10158655
175 Ga0157380_10509678
176 Ga0182008_10070480
177 Ga0157379_10160002
178 Ga0157376_10086144
179 Ga0214544_1000029
180 Ga0214542_1000092
181 Ga0214543_1000045
182 Ga0213873_10034411
183 Ga0213872_10059535
184 Ga0213876_10062602
185 Ga0213875_10001127
186 Ga0213875_10161317
187 Ga0209256_1000286
188 Ga0207692_10042228
189 Ga0207699_10008286
190 Ga0207699_10078421
191 Ga0207707_10335970
192 Ga0207693_10002822
193 Ga0207693_10138912
194 Ga0207693_10274931
195 Ga0207646_10026494
196 Ga0207650_10517562
197 Ga0207700_10003148
198 Ga0207700_10178233
199 Ga0207700_10572268
200 Ga0207664_10062730
201 Ga0207664_10428939
202 Ga0207668_10041222
203 Ga0207678_10155737
204 Ga0268266_10263880
205 Ga0265327_10074510
206 Ga0307408_100004861
207 Ga0307408_100085236
208 Ga0316578_10111172
209 Ga0307410_10104290
210 Ga0307409_100752296
211 Ga0307416_100061038
212 Ga0307414_10004614
213 Ga0307414_10027055
214 Ga0307411_10044604
215 Ga0373934_0107761
216 Ga0373936_0074690
217 Ga0373957_0006077
218 Ga0373943_0187396
219 Ga0373955_0013695
220 Ga0373961_0060025
221 Ga0373931_0340928
222 Ga0373933_0015695
223 Ga0373947_0161731
224 Ga0373937_0032275
225 Ga0373937_0056185
226 Ga0373937_0096278
227 Ga0316584_0057443
228 Ga0316584_0190559
229 Ga0373925_0062384
230 Ga0395900_0247319
231 Ga0395898_0801585
232 Ga0436364_0022735
233 Ga0436364_0082987
234 Ga0436364_0764984
235 Ga0400483_138466
236 Ga0436365_0352243
237 Ga0436365_0680443
238 Ga0436361_0070611
239 Ga0436361_0455164
240 Ga0436361_0746172
241 Ga0436361_0827335
242 Ga0436361_1057931
243 Ga0436363_1295837
244 Ga0436362_0610463
245 Ga0436362_0921965
246 Ga0439431_0024749
247 Ga0451576_0004319
248 Ga0495592_0069804
249 Ga0495638_0046777
250 Ga0495580_0094951
251 Ga0495628_0107049
252 Ga0495640_0117659
253 Ga0495586_0023638
254 Ga0495667_0031228
255 Ga0495667_0057202
256 Ga0495634_0064734
257 Ga0495599_0063298
258 Ga0495600_0021186
259 Ga0495604_0090070
260 Ga0495680_0151703
261 Ga0495680_0303000
262 Ga0496110_0788588
263 Ga0496111_0479127
264 Ga0496113_0117204
265 Ga0496120_0125436
266 Ga0501039_0232653
267 Ga0501041_0093478
268 Ga0501071_0044171
269 Ga0501072_0095776
270 Ga0501081_0500392
271 Ga0501035_0471632
272 Ga0501044_0136403
273 nmdc:mga08y16_170501_c1
274 nmdc:mga0rr50_148994_c1
275 nmdc:mga08x19_51612_c1
276 Ga0495601_0009841
277 Ga0495595_0004996
278 Ga0495595_0110763
279 Ga0495619_0016494
280 Ga0500616_0074987
281 Ga0501082_0236503
282 2643807884
283 2643950967
284 2644068036
285 2644129501
286 2644207570
287 2644378225
288 2644418899
289 2644452326
290 2644651319
291 2644687070
292 2883355323
293 2919681799
294 2941503053
295 8002290006
296 8054568299

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00459

Inositol_P

Inositol monophosphatase family

3

260

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lv0-assembly1.cif.gz_A crystal structure of extragenic suppressor protein suhb from bartonella henselae, native 0.9286 10 259
4n81-assembly1.cif.gz_A-2 another flexible region at the active site of an inositol monophosphatase from zymomonas mobilis 0.9255 10 261
5eq8-assembly1.cif.gz_A-2 crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with l-histidinol 0.9193 11 261
2p3v-assembly1.cif.gz_A thermotoga maritima impase tm1415 0.9182 10 260
2bji-assembly1.cif.gz_B high resolution structure of myo-inositol monophosphatase, the target of lithium therapy 0.9164 10 259
ID Description Score Start End Superfamily
4n81A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9373 144 261 3.40.190.80
4n81A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9297 144 261 3.40.190.80
2p3nA01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9252 11 143 3.30.540.10
af_Q6F2U7_1_143_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9236 10 142 3.30.540.10
af_A0A1D6FBS3_220_343_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9233 146 261 3.40.190.80
ID Description Score Start End GO Terms
AF-A0A090DF45-F1-model_v4 Bifunctional phosphatase IMPL2, chloroplastic (EC 3.1.3.15, EC 3.1.3.25) 0.9913 57 259 GO:0000105
GO:0004401
GO:0046872
GO:0052834
AF-A0A3D3IU20-F1-model_v4 Histidinol phosphate phosphatase 0.974 10 261 GO:0000105
GO:0016791
GO:0046872
AF-A0A6J4WYB3-F1-model_v4 Histidinol-phosphatase 0.9713 10 261 GO:0000105
GO:0042578
GO:0046872
AF-A0A2E3KBT8-F1-model_v4 Histidinol phosphate phosphatase 0.9704 11 259 GO:0000105
GO:0016791
GO:0046872
AF-A0A7V8F882-F1-model_v4 Histidinol-phosphatase (EC 3.1.3.15) 0.9699 10 261 GO:0000105
GO:0004401
GO:0046872

Map