F203328
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 148 | 119 | 296 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300025898|Ga0207692_10100873|Ga0207692_101008732 |
| Length | 300 |
| Sequence | VAELDAFLALASDLADAAGAAIRPHFRQRIAVDDKADLSPVTIADRNAEAAMRRLIAARFPDHGIIGEEYGAQRETAEFVWVLDPIDGTKSFISGVPLFGTLVALAHHGRPILGIIDQPISRERWIGASGRPTTLNGSAVHCRPCPKLAAATLFSTSPDMFKGADAAAQARVAAKAKLVRYGADCYAYGLVALGLIDLVIEASLKPYDFSAMAPIVEGAGGIATDWQGQKLSLASDGRVVVAGDPHVHSPGVTKKMREQAFSGQGRLRLRRDLLVFVEPGLEAVAGQLPDGPPAGGEQRV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 3 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 16 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 19 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 20 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 21 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 22 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 23 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 24 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 25 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 27 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 28 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 29 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 30 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 31 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 32 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 33 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 34 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 45 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 46 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 47 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 48 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 49 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 50 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 51 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 52 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 53 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 54 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 55 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 56 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 57 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 58 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 59 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 60 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 61 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 62 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 63 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 64 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 65 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 66 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 67 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 68 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 69 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 70 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 71 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 72 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 73 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 74 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 87 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 88 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 89 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 90 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 91 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 92 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 93 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 94 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 95 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 96 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 97 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 98 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 99 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 100 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 104 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 105 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 106 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 107 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 108 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 109 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 110 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 111 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 112 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 113 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 114 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 115 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 116 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 117 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 118 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 119 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.86 |
| Metatranscriptomes | 0 |
| Isolates | 10.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.03 |
| Nodule | 2.7 |
| Rhizoplane | 2.03 |
| Rhizosphere | 77.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207692_10100873 | 3300025898 | Bacteria | 1584 |
| 2 | Ga0055524_1000708 | 3300003775 | Bacteria | 23047 |
| 3 | Ga0070660_100043501 | 3300005339 | Bacteria | 3432 |
| 4 | Ga0070668_100030680 | 3300005347 | Bacteria | 4089 |
| 5 | Ga0070671_100549341 | 3300005355 | Bacteria | 996 |
| 6 | Ga0070709_10008936 | 3300005434 | Bacteria | 5515 |
| 7 | Ga0070709_10032063 | 3300005434 | Bacteria | 3166 |
| 8 | Ga0070714_100024597 | 3300005435 | Bacteria | 4962 |
| 9 | Ga0070714_100279196 | 3300005435 | Bacteria | 1551 |
| 10 | Ga0070714_100302133 | 3300005435 | Bacteria | 1492 |
| 11 | Ga0070713_100003126 | 3300005436 | Bacteria | 10898 |
| 12 | Ga0070711_100010035 | 3300005439 | Bacteria | 5846 |
| 13 | Ga0070708_100304946 | 3300005445 | Bacteria | 1500 |
| 14 | Ga0070681_10427742 | 3300005458 | Bacteria | 1236 |
| 15 | Ga0070707_100037641 | 3300005468 | Bacteria | 4618 |
| 16 | Ga0070698_100005644 | 3300005471 | Bacteria | 13697 |
| 17 | Ga0070698_100288352 | 3300005471 | Unclassified | 1573 |
| 18 | Ga0070686_100221680 | 3300005544 | Bacteria | 1367 |
| 19 | Ga0081540_1004333 | 3300005983 | Bacteria | 10871 |
| 20 | Ga0070717_10007184 | 3300006028 | Bacteria | 8254 |
| 21 | Ga0070717_10137125 | 3300006028 | Bacteria | 2108 |
| 22 | Ga0070712_100150383 | 3300006175 | Bacteria | 1787 |
| 23 | Ga0075434_100533589 | 3300006871 | Bacteria | 1194 |
| 24 | Ga0111539_10139571 | 3300009094 | Bacteria | 2838 |
| 25 | Ga0099796_10106706 | 3300010159 | Bacteria | 1061 |
| 26 | Ga0163162_10158655 | 3300013306 | Bacteria | 2383 |
| 27 | Ga0157380_10509678 | 3300014326 | Bacteria | 1171 |
| 28 | Ga0182008_10070480 | 3300014497 | Bacteria | 1720 |
| 29 | Ga0157379_10160002 | 3300014968 | Bacteria | 2033 |
| 30 | Ga0157376_10086144 | 3300014969 | Bacteria | 2708 |
| 31 | Ga0214544_1000029 | 3300021320 | Bacteria | 153924 |
| 32 | Ga0214542_1000092 | 3300021321 | Bacteria | 117288 |
| 33 | Ga0214543_1000045 | 3300021327 | Bacteria | 152699 |
| 34 | Ga0213873_10034411 | 3300021358 | Bacteria | 1277 |
| 35 | Ga0213872_10059535 | 3300021361 | Bacteria | 1728 |
| 36 | Ga0213876_10062602 | 3300021384 | Bacteria | 1964 |
| 37 | Ga0213875_10001127 | 3300021388 | Bacteria | 18428 |
| 38 | Ga0213875_10161317 | 3300021388 | Bacteria | 1051 |
| 39 | Ga0209256_1000286 | 3300025299 | Bacteria | 88880 |
| 40 | Ga0207692_10042228 | 3300025898 | Bacteria | 2262 |
| 41 | Ga0207699_10008286 | 3300025906 | Bacteria | 5121 |
| 42 | Ga0207699_10078421 | 3300025906 | Bacteria | 2040 |
| 43 | Ga0207707_10335970 | 3300025912 | Bacteria | 1303 |
| 44 | Ga0207693_10002822 | 3300025915 | Bacteria | 15058 |
| 45 | Ga0207693_10138912 | 3300025915 | Bacteria | 1911 |
| 46 | Ga0207693_10274931 | 3300025915 | Bacteria | 1320 |
| 47 | Ga0207646_10026494 | 3300025922 | Bacteria | 5289 |
| 48 | Ga0207650_10517562 | 3300025925 | Bacteria | 998 |
| 49 | Ga0207700_10003148 | 3300025928 | Bacteria | 9523 |
| 50 | Ga0207700_10178233 | 3300025928 | Bacteria | 1778 |
| 51 | Ga0207700_10572268 | 3300025928 | Bacteria | 1004 |
| 52 | Ga0207664_10062730 | 3300025929 | Bacteria | 2969 |
| 53 | Ga0207664_10428939 | 3300025929 | Bacteria | 1178 |
| 54 | Ga0207668_10041222 | 3300025972 | Bacteria | 3120 |
| 55 | Ga0207678_10155737 | 3300026067 | Bacteria | 1951 |
| 56 | Ga0268266_10263880 | 3300028379 | Bacteria | 1597 |
| 57 | Ga0265327_10074510 | 3300031251 | Bacteria | 1690 |
| 58 | Ga0307408_100004861 | 3300031548 | Bacteria | 9050 |
| 59 | Ga0307408_100085236 | 3300031548 | Bacteria | 2372 |
| 60 | Ga0316578_10111172 | 3300031728 | Bacteria | 1646 |
| 61 | Ga0307410_10104290 | 3300031852 | Bacteria | 2038 |
| 62 | Ga0307409_100752296 | 3300031995 | Bacteria | 978 |
| 63 | Ga0307416_100061038 | 3300032002 | Bacteria | 3074 |
| 64 | Ga0307414_10004614 | 3300032004 | Bacteria | 7494 |
| 65 | Ga0307414_10027055 | 3300032004 | Bacteria | 3700 |
| 66 | Ga0307411_10044604 | 3300032005 | Bacteria | 2846 |
| 67 | Ga0373934_0107761 | 3300035086 | Bacteria | 1129 |
| 68 | Ga0373936_0074690 | 3300035113 | Bacteria | 1403 |
| 69 | Ga0373957_0006077 | 3300035120 | Bacteria | 3783 |
| 70 | Ga0373943_0187396 | 3300035170 | Bacteria | 1140 |
| 71 | Ga0373955_0013695 | 3300035172 | Bacteria | 3930 |
| 72 | Ga0373961_0060025 | 3300035241 | Bacteria | 1151 |
| 73 | Ga0373931_0340928 | 3300035691 | Bacteria | 936 |
| 74 | Ga0373933_0015695 | 3300035724 | Bacteria | 4225 |
| 75 | Ga0373947_0161731 | 3300035725 | Bacteria | 1448 |
| 76 | Ga0373937_0032275 | 3300036401 | Bacteria | 4749 |
| 77 | Ga0373937_0056185 | 3300036401 | Bacteria | 3614 |
| 78 | Ga0373937_0096278 | 3300036401 | Bacteria | 2745 |
| 79 | Ga0316584_0057443 | 3300036712 | Bacteria | 2913 |
| 80 | Ga0316584_0190559 | 3300036712 | Bacteria | 1516 |
| 81 | Ga0373925_0062384 | 3300037068 | Bacteria | 2803 |
| 82 | Ga0395900_0247319 | 3300037418 | Bacteria | 1786 |
| 83 | Ga0395898_0801585 | 3300037466 | Bacteria | 882 |
| 84 | Ga0436364_0022735 | 3300037853 | Bacteria | 162985 |
| 85 | Ga0436364_0082987 | 3300037853 | Bacteria | 54429 |
| 86 | Ga0436364_0764984 | 3300037853 | Bacteria | 1641 |
| 87 | Ga0400483_138466 | 3300039062 | Bacteria | 2028 |
| 88 | Ga0436365_0352243 | 3300039437 | Bacteria | 2402 |
| 89 | Ga0436365_0680443 | 3300039437 | Bacteria | 1332 |
| 90 | Ga0436361_0070611 | 3300039447 | Bacteria | 6508 |
| 91 | Ga0436361_0455164 | 3300039447 | Unclassified | 993 |
| 92 | Ga0436361_0746172 | 3300039447 | Bacteria | 1502 |
| 93 | Ga0436361_0827335 | 3300039447 | Bacteria | 1037 |
| 94 | Ga0436361_1057931 | 3300039447 | Bacteria | 1073 |
| 95 | Ga0436363_1295837 | 3300039450 | Bacteria | 2720 |
| 96 | Ga0436362_0610463 | 3300039453 | Bacteria | 5809 |
| 97 | Ga0436362_0921965 | 3300039453 | Bacteria | 1198 |
| 98 | Ga0439431_0024749 | 3300041997 | Bacteria | 1463 |
| 99 | Ga0451576_0004319 | 3300045051 | Bacteria | 18565 |
| 100 | Ga0495592_0069804 | 3300046454 | Bacteria | 2561 |
| 101 | Ga0495638_0046777 | 3300046460 | Bacteria | 2717 |
| 102 | Ga0495580_0094951 | 3300046472 | Bacteria | 2074 |
| 103 | Ga0495628_0107049 | 3300046516 | Bacteria | 2153 |
| 104 | Ga0495640_0117659 | 3300046533 | Bacteria | 1730 |
| 105 | Ga0495586_0023638 | 3300046535 | Bacteria | 3283 |
| 106 | Ga0495667_0031228 | 3300046559 | Bacteria | 3576 |
| 107 | Ga0495667_0057202 | 3300046559 | Bacteria | 2564 |
| 108 | Ga0495634_0064734 | 3300046642 | Bacteria | 2423 |
| 109 | Ga0495599_0063298 | 3300046678 | Bacteria | 2311 |
| 110 | Ga0495600_0021186 | 3300046809 | Bacteria | 4162 |
| 111 | Ga0495604_0090070 | 3300047317 | Bacteria | 2279 |
| 112 | Ga0495680_0151703 | 3300047322 | Bacteria | 1689 |
| 113 | Ga0495680_0303000 | 3300047322 | Bacteria | 1122 |
| 114 | Ga0496110_0788588 | 3300048913 | Bacteria | 854 |
| 115 | Ga0496111_0479127 | 3300048914 | Bacteria | 917 |
| 116 | Ga0496113_0117204 | 3300048916 | Bacteria | 2079 |
| 117 | Ga0496120_0125436 | 3300048923 | Bacteria | 1322 |
| 118 | Ga0501039_0232653 | 3300049575 | Bacteria | 1449 |
| 119 | Ga0501041_0093478 | 3300049577 | Bacteria | 1857 |
| 120 | Ga0501071_0044171 | 3300049587 | Bacteria | 3196 |
| 121 | Ga0501072_0095776 | 3300049588 | Bacteria | 2359 |
| 122 | Ga0501081_0500392 | 3300049743 | Bacteria | 905 |
| 123 | Ga0501035_0471632 | 3300049822 | Bacteria | 1036 |
| 124 | Ga0501044_0136403 | 3300049823 | Bacteria | 2445 |
| 125 | nmdc:mga08y16_170501_c1 | 3300050511 | Bacteria | 2260 |
| 126 | nmdc:mga0rr50_148994_c1 | 3300050513 | Bacteria | 1889 |
| 127 | nmdc:mga08x19_51612_c1 | 3300050514 | Bacteria | 2643 |
| 128 | Ga0495601_0009841 | 3300053077 | Bacteria | 5658 |
| 129 | Ga0495595_0004996 | 3300053084 | Bacteria | 5357 |
| 130 | Ga0495595_0110763 | 3300053084 | Bacteria | 1331 |
| 131 | Ga0495619_0016494 | 3300053085 | Bacteria | 4677 |
| 132 | Ga0500616_0074987 | 3300053153 | Bacteria | 1713 |
| 133 | Ga0501082_0236503 | 3300060353 | Bacteria | 1590 |
| 134 | 2643807884 | 2643221557 | Bacteria | 7184309 |
| 135 | 2643950967 | 2643221588 | Bacteria | 3692460 |
| 136 | 2644068036 | 2643221610 | Bacteria | 7480339 |
| 137 | 2644129501 | 2643221623 | Bacteria | 5239945 |
| 138 | 2644207570 | 2643221637 | Bacteria | 5345260 |
| 139 | 2644378225 | 2643221668 | Bacteria | 7306521 |
| 140 | 2644418899 | 2643221675 | Bacteria | 7473456 |
| 141 | 2644452326 | 2643221680 | Bacteria | 7473610 |
| 142 | 2644651319 | 2643221718 | Bacteria | 5345506 |
| 143 | 2644687070 | 2643221726 | Bacteria | 7455827 |
| 144 | 2883355323 | 2883354860 | Bacteria | 5865246 |
| 145 | 2919681799 | 2919679072 | Bacteria | 4629602 |
| 146 | 2941503053 | 2941499720 | Bacteria | 7599444 |
| 147 | 8002290006 | 8002285264 | Bacteria | 6717907 |
| 148 | 8054568299 | 8054563764 | Bacteria | 5592885 |
| 149 | Ga0207692_10100873 | |||
| 150 | Ga0055524_1000708 | |||
| 151 | Ga0070660_100043501 | |||
| 152 | Ga0070668_100030680 | |||
| 153 | Ga0070671_100549341 | |||
| 154 | Ga0070709_10008936 | |||
| 155 | Ga0070709_10032063 | |||
| 156 | Ga0070714_100024597 | |||
| 157 | Ga0070714_100279196 | |||
| 158 | Ga0070714_100302133 | |||
| 159 | Ga0070713_100003126 | |||
| 160 | Ga0070711_100010035 | |||
| 161 | Ga0070708_100304946 | |||
| 162 | Ga0070681_10427742 | |||
| 163 | Ga0070707_100037641 | |||
| 164 | Ga0070698_100005644 | |||
| 165 | Ga0070698_100288352 | |||
| 166 | Ga0070686_100221680 | |||
| 167 | Ga0081540_1004333 | |||
| 168 | Ga0070717_10007184 | |||
| 169 | Ga0070717_10137125 | |||
| 170 | Ga0070712_100150383 | |||
| 171 | Ga0075434_100533589 | |||
| 172 | Ga0111539_10139571 | |||
| 173 | Ga0099796_10106706 | |||
| 174 | Ga0163162_10158655 | |||
| 175 | Ga0157380_10509678 | |||
| 176 | Ga0182008_10070480 | |||
| 177 | Ga0157379_10160002 | |||
| 178 | Ga0157376_10086144 | |||
| 179 | Ga0214544_1000029 | |||
| 180 | Ga0214542_1000092 | |||
| 181 | Ga0214543_1000045 | |||
| 182 | Ga0213873_10034411 | |||
| 183 | Ga0213872_10059535 | |||
| 184 | Ga0213876_10062602 | |||
| 185 | Ga0213875_10001127 | |||
| 186 | Ga0213875_10161317 | |||
| 187 | Ga0209256_1000286 | |||
| 188 | Ga0207692_10042228 | |||
| 189 | Ga0207699_10008286 | |||
| 190 | Ga0207699_10078421 | |||
| 191 | Ga0207707_10335970 | |||
| 192 | Ga0207693_10002822 | |||
| 193 | Ga0207693_10138912 | |||
| 194 | Ga0207693_10274931 | |||
| 195 | Ga0207646_10026494 | |||
| 196 | Ga0207650_10517562 | |||
| 197 | Ga0207700_10003148 | |||
| 198 | Ga0207700_10178233 | |||
| 199 | Ga0207700_10572268 | |||
| 200 | Ga0207664_10062730 | |||
| 201 | Ga0207664_10428939 | |||
| 202 | Ga0207668_10041222 | |||
| 203 | Ga0207678_10155737 | |||
| 204 | Ga0268266_10263880 | |||
| 205 | Ga0265327_10074510 | |||
| 206 | Ga0307408_100004861 | |||
| 207 | Ga0307408_100085236 | |||
| 208 | Ga0316578_10111172 | |||
| 209 | Ga0307410_10104290 | |||
| 210 | Ga0307409_100752296 | |||
| 211 | Ga0307416_100061038 | |||
| 212 | Ga0307414_10004614 | |||
| 213 | Ga0307414_10027055 | |||
| 214 | Ga0307411_10044604 | |||
| 215 | Ga0373934_0107761 | |||
| 216 | Ga0373936_0074690 | |||
| 217 | Ga0373957_0006077 | |||
| 218 | Ga0373943_0187396 | |||
| 219 | Ga0373955_0013695 | |||
| 220 | Ga0373961_0060025 | |||
| 221 | Ga0373931_0340928 | |||
| 222 | Ga0373933_0015695 | |||
| 223 | Ga0373947_0161731 | |||
| 224 | Ga0373937_0032275 | |||
| 225 | Ga0373937_0056185 | |||
| 226 | Ga0373937_0096278 | |||
| 227 | Ga0316584_0057443 | |||
| 228 | Ga0316584_0190559 | |||
| 229 | Ga0373925_0062384 | |||
| 230 | Ga0395900_0247319 | |||
| 231 | Ga0395898_0801585 | |||
| 232 | Ga0436364_0022735 | |||
| 233 | Ga0436364_0082987 | |||
| 234 | Ga0436364_0764984 | |||
| 235 | Ga0400483_138466 | |||
| 236 | Ga0436365_0352243 | |||
| 237 | Ga0436365_0680443 | |||
| 238 | Ga0436361_0070611 | |||
| 239 | Ga0436361_0455164 | |||
| 240 | Ga0436361_0746172 | |||
| 241 | Ga0436361_0827335 | |||
| 242 | Ga0436361_1057931 | |||
| 243 | Ga0436363_1295837 | |||
| 244 | Ga0436362_0610463 | |||
| 245 | Ga0436362_0921965 | |||
| 246 | Ga0439431_0024749 | |||
| 247 | Ga0451576_0004319 | |||
| 248 | Ga0495592_0069804 | |||
| 249 | Ga0495638_0046777 | |||
| 250 | Ga0495580_0094951 | |||
| 251 | Ga0495628_0107049 | |||
| 252 | Ga0495640_0117659 | |||
| 253 | Ga0495586_0023638 | |||
| 254 | Ga0495667_0031228 | |||
| 255 | Ga0495667_0057202 | |||
| 256 | Ga0495634_0064734 | |||
| 257 | Ga0495599_0063298 | |||
| 258 | Ga0495600_0021186 | |||
| 259 | Ga0495604_0090070 | |||
| 260 | Ga0495680_0151703 | |||
| 261 | Ga0495680_0303000 | |||
| 262 | Ga0496110_0788588 | |||
| 263 | Ga0496111_0479127 | |||
| 264 | Ga0496113_0117204 | |||
| 265 | Ga0496120_0125436 | |||
| 266 | Ga0501039_0232653 | |||
| 267 | Ga0501041_0093478 | |||
| 268 | Ga0501071_0044171 | |||
| 269 | Ga0501072_0095776 | |||
| 270 | Ga0501081_0500392 | |||
| 271 | Ga0501035_0471632 | |||
| 272 | Ga0501044_0136403 | |||
| 273 | nmdc:mga08y16_170501_c1 | |||
| 274 | nmdc:mga0rr50_148994_c1 | |||
| 275 | nmdc:mga08x19_51612_c1 | |||
| 276 | Ga0495601_0009841 | |||
| 277 | Ga0495595_0004996 | |||
| 278 | Ga0495595_0110763 | |||
| 279 | Ga0495619_0016494 | |||
| 280 | Ga0500616_0074987 | |||
| 281 | Ga0501082_0236503 | |||
| 282 | 2643807884 | |||
| 283 | 2643950967 | |||
| 284 | 2644068036 | |||
| 285 | 2644129501 | |||
| 286 | 2644207570 | |||
| 287 | 2644378225 | |||
| 288 | 2644418899 | |||
| 289 | 2644452326 | |||
| 290 | 2644651319 | |||
| 291 | 2644687070 | |||
| 292 | 2883355323 | |||
| 293 | 2919681799 | |||
| 294 | 2941503053 | |||
| 295 | 8002290006 | |||
| 296 | 8054568299 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lv0-assembly1.cif.gz_A | crystal structure of extragenic suppressor protein suhb from bartonella henselae, native | 0.9286 | 10 | 259 |
| 4n81-assembly1.cif.gz_A-2 | another flexible region at the active site of an inositol monophosphatase from zymomonas mobilis | 0.9255 | 10 | 261 |
| 5eq8-assembly1.cif.gz_A-2 | crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with l-histidinol | 0.9193 | 11 | 261 |
| 2p3v-assembly1.cif.gz_A | thermotoga maritima impase tm1415 | 0.9182 | 10 | 260 |
| 2bji-assembly1.cif.gz_B | high resolution structure of myo-inositol monophosphatase, the target of lithium therapy | 0.9164 | 10 | 259 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4n81A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9373 | 144 | 261 | 3.40.190.80 |
| 4n81A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9297 | 144 | 261 | 3.40.190.80 |
| 2p3nA01 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 | 0.9252 | 11 | 143 | 3.30.540.10 |
| af_Q6F2U7_1_143_3.30.540.10 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 | 0.9236 | 10 | 142 | 3.30.540.10 |
| af_A0A1D6FBS3_220_343_3.40.190.80 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9233 | 146 | 261 | 3.40.190.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A090DF45-F1-model_v4 | Bifunctional phosphatase IMPL2, chloroplastic (EC 3.1.3.15, EC 3.1.3.25) | 0.9913 | 57 | 259 |
GO:0000105
GO:0004401 GO:0046872 GO:0052834 |
| AF-A0A3D3IU20-F1-model_v4 | Histidinol phosphate phosphatase | 0.974 | 10 | 261 |
GO:0000105
GO:0016791 GO:0046872 |
| AF-A0A6J4WYB3-F1-model_v4 | Histidinol-phosphatase | 0.9713 | 10 | 261 |
GO:0000105
GO:0042578 GO:0046872 |
| AF-A0A2E3KBT8-F1-model_v4 | Histidinol phosphate phosphatase | 0.9704 | 11 | 259 |
GO:0000105
GO:0016791 GO:0046872 |
| AF-A0A7V8F882-F1-model_v4 | Histidinol-phosphatase (EC 3.1.3.15) | 0.9699 | 10 | 261 |
GO:0000105
GO:0004401 GO:0046872 |