F203065

General Info

Members Datasets Scaffolds Average Seq Length
148 100 138 145

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10226729|Ga0105241_102267293
Length 159
Sequence MGDPDIPPRAGHGRMTGMTERYDPAEFVARMPEGMGALNEKMGIELVEISAEKVVATMPVKGNTQPYGLLHGGASVVLAETLGSVGSALHALPDKLSVGVDINATHHRSATSGVVTGTATAIHLGRSSTSYDVVITDEQGRRVCTARITCALMPAQKYS

Samples

Sample ID Description Type Environment
1 2643221617 Nocardioides sp. Root79 Isolate Unclassified
2 2643221620 Nocardioides sp. Root240 Isolate Unclassified
3 2738541305 Nocardioides sp. CF167 Isolate Unclassified
4 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
5 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
6 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
7 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
8 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
9 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
38 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
39 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
40 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
41 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
42 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
43 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
44 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
45 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
46 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
47 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
48 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
49 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
50 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
51 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
52 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
53 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
54 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
55 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
56 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
57 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
58 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
59 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
60 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
61 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
64 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
65 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
66 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
67 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
68 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
69 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
70 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
71 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
72 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
85 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
86 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
87 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
88 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
89 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
90 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
91 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
94 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
95 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
96 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
97 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
98 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
99 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
100 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.24
Metatranscriptomes 0
Isolates 6.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.68
Bulb 0
Endosphere 3.38
Nodule 0.68
Rhizoplane 1.35
Rhizosphere 84.46
Stem 0
Stem Tuber 0
Unclassified 9.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10084679 3300005327 Bacteria 2607
2 Ga0070683_102106022 3300005329 Bacteria 542
3 Ga0070666_11052808 3300005335 Bacteria 604
4 Ga0068868_101444842 3300005338 Bacteria 642
5 Ga0070660_100008233 3300005339 Bacteria 7287
6 Ga0070659_100021985 3300005366 Bacteria 4866
7 Ga0070659_100143802 3300005366 Bacteria 1942
8 Ga0070663_100179246 3300005455 Bacteria 1642
9 Ga0070663_101016197 3300005455 Bacteria 721
10 Ga0070698_100005020 3300005471 Bacteria 14497
11 Ga0068853_102070538 3300005539 Bacteria 552
12 Ga0070664_100037838 3300005564 Bacteria 4058
13 Ga0075365_10465363 3300006038 Bacteria 893
14 Ga0105241_10226729 3300009174 Bacteria 1573
15 Ga0105242_10467381 3300009176 Bacteria 1192
16 Ga0105237_10344422 3300009545 Bacteria 1495
17 Ga0105249_10148202 3300009553 Bacteria 2256
18 Ga0105239_10147141 3300010375 Bacteria 2628
19 Ga0105239_10258001 3300010375 Bacteria 1959
20 Ga0105246_10161329 3300011119 Bacteria 1708
21 Ga0207647_10011806 3300025904 Bacteria 6106
22 Ga0207705_10081427 3300025909 Bacteria 2359
23 Ga0207657_10010282 3300025919 Bacteria 9341
24 Ga0207649_10246875 3300025920 Bacteria 1284
25 Ga0207690_10005067 3300025932 Bacteria 7782
26 Ga0207686_10766052 3300025934 Bacteria 771
27 Ga0207679_10101901 3300025945 Bacteria 2247
28 Ga0207712_10090082 3300025961 Bacteria 2256
29 Ga0207639_11872507 3300026041 Bacteria 561
30 Ga0207678_10207133 3300026067 Bacteria 1678
31 Ga0207678_10863621 3300026067 Bacteria 800
32 Ga0316176_1126915 3300030732 Bacteria 1071
33 Ga0316181_1131385 3300030744 Bacteria 3148
34 Ga0316182_1169616 3300030745 Bacteria 873
35 Ga0307411_10872529 3300032005 Bacteria 798
36 Ga0395899_0115554 3300037312 Bacteria 1926
37 Ga0395900_0256055 3300037418 Bacteria 1750
38 Ga0395900_0396906 3300037418 Bacteria 1344
39 Ga0395898_0195525 3300037466 Bacteria 1932
40 Ga0395905_0013780 3300037471 Bacteria 7740
41 Ga0395901_0015246 3300038443 Bacteria 7821
42 Ga0395901_0102110 3300038443 Bacteria 3009
43 Ga0395901_0673841 3300038443 Bacteria 1035
44 Ga0451807_1193133 3300041486 Bacteria 1459
45 Ga0451837_0723616 3300041494 Bacteria 512
46 Ga0451847_0351324 3300041503 Bacteria 558
47 Ga0451853_3277386 3300041512 Bacteria 704
48 Ga0466972_0003869 3300044658 Bacteria 7454
49 Ga0466972_0190232 3300044658 Bacteria 962
50 Ga0466972_0247873 3300044658 Bacteria 833
51 Ga0466965_0001666 3300044683 Bacteria 9114
52 Ga0466965_0005453 3300044683 Bacteria 5734
53 Ga0466965_0014863 3300044683 Bacteria 3690
54 Ga0466965_0318929 3300044683 Bacteria 846
55 Ga0466966_0199415 3300044684 Bacteria 1211
56 Ga0466966_0226542 3300044684 Bacteria 1128
57 Ga0466966_0711642 3300044684 Bacteria 605
58 Ga0466961_0254353 3300044693 Bacteria 1078
59 Ga0466961_0549950 3300044693 Bacteria 695
60 Ga0466963_0098671 3300044694 Bacteria 1997
61 Ga0466964_0029602 3300044706 Bacteria 2163
62 Ga0466964_0047102 3300044706 Bacteria 1759
63 Ga0466964_0212299 3300044706 Bacteria 935
64 Ga0466971_0014217 3300044719 Bacteria 3499
65 Ga0466971_0022302 3300044719 Bacteria 2821
66 Ga0466968_0074731 3300044735 Bacteria 1480
67 Ga0466968_0077820 3300044735 Bacteria 1453
68 Ga0466970_0002238 3300044765 Bacteria 9332
69 Ga0466970_0004319 3300044765 Bacteria 6992
70 Ga0466970_0005591 3300044765 Bacteria 6246
71 Ga0466970_0006353 3300044765 Bacteria 5904
72 Ga0466970_0028468 3300044765 Bacteria 2936
73 Ga0466970_0040094 3300044765 Bacteria 2486
74 Ga0466970_0041726 3300044765 Bacteria 2439
75 Ga0466970_0076488 3300044765 Bacteria 1804
76 Ga0466970_0661445 3300044765 Bacteria 608
77 Ga0466957_0001696 3300044842 Bacteria 11580
78 Ga0466957_0105761 3300044842 Bacteria 1779
79 Ga0466957_0747879 3300044842 Bacteria 692
80 Ga0466960_0001040 3300044901 Bacteria 9930
81 Ga0466960_0034330 3300044901 Bacteria 2363
82 Ga0466960_0035037 3300044901 Bacteria 2343
83 Ga0466960_0040619 3300044901 Bacteria 2201
84 Ga0466960_0888387 3300044901 Bacteria 543
85 Ga0466958_0014844 3300045836 Bacteria 4452
86 Ga0466958_0275314 3300045836 Bacteria 1078
87 Ga0466967_0021105 3300045976 Bacteria 5279
88 Ga0466967_0296378 3300045976 Bacteria 1555
89 Ga0466967_0869887 3300045976 Bacteria 896
90 Ga0466967_1063814 3300045976 Bacteria 806
91 Ga0466967_1599179 3300045976 Bacteria 649
92 Ga0495652_0665599 3300046529 Bacteria 704
93 Ga0495635_0541284 3300046663 Bacteria 764
94 Ga0495647_0287881 3300046681 Unclassified 738
95 Ga0495658_0014222 3300046683 Bacteria 4062
96 Ga0495658_0284930 3300046683 Unclassified 1043
97 Ga0495676_0348939 3300047321 Unclassified 989
98 Ga0496105_0180634 3300048908 Bacteria 1728
99 Ga0496122_0000275 3300048925 Bacteria 114580
100 Ga0496123_0000166 3300048926 Bacteria 131527
101 Ga0496124_0001046 3300048927 Bacteria 43693
102 Ga0501032_0058851 3300049569 Bacteria 2579
103 Ga0501033_0881386 3300049570 Bacteria 602
104 Ga0501034_0033941 3300049571 Bacteria 5173
105 Ga0501034_1179991 3300049571 Bacteria 645
106 Ga0501034_1329436 3300049571 Bacteria 595
107 Ga0501036_0005667 3300049572 Bacteria 10133
108 Ga0501036_0814808 3300049572 Bacteria 768
109 Ga0501037_0032979 3300049573 Bacteria 3826
110 Ga0501038_0001626 3300049574 Bacteria 20909
111 Ga0501039_0073507 3300049575 Bacteria 2656
112 Ga0501039_1199115 3300049575 Bacteria 587
113 Ga0501040_0886644 3300049576 Bacteria 646
114 Ga0501041_0485641 3300049577 Bacteria 785
115 Ga0501041_0876518 3300049577 Bacteria 576
116 Ga0501042_0008017 3300049578 Bacteria 6950
117 Ga0501042_0210862 3300049578 Bacteria 1401
118 Ga0501046_0110934 3300049580 Bacteria 2095
119 Ga0501047_0002734 3300049581 Bacteria 16802
120 Ga0501068_1017389 3300049584 Bacteria 547
121 Ga0501070_0018573 3300049586 Bacteria 5832
122 Ga0501071_0145090 3300049587 Bacteria 1769
123 Ga0501071_1584983 3300049587 Bacteria 505
124 Ga0501072_0059909 3300049588 Bacteria 3002
125 Ga0501073_0030181 3300049589 Bacteria 3872
126 Ga0501074_0670784 3300049590 Bacteria 732
127 Ga0501075_0139227 3300049591 Bacteria 1849
128 Ga0501035_0004295 3300049822 Bacteria 13532
129 Ga0501044_0007051 3300049823 Bacteria 12365
130 Ga0501045_0404995 3300049824 Bacteria 1015
131 nmdc:mga0yw44_246145_c1 3300050492 Bacteria 1189
132 nmdc:mga0yw44_2565_c1 3300050492 Bacteria 7799
133 nmdc:mga06z11_5499_c1 3300050494 Bacteria 5089
134 nmdc:mga07m45_99733_c1 3300050496 Bacteria 1667
135 Ga0495655_0334254 3300053083 Bacteria 527
136 Ga0466962_0004968 3300061719 Bacteria 6396
137 Ga0466962_0289000 3300061719 Bacteria 810
138 Ga0530510_0574828 3300061734 Bacteria 857

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044693 Ga0466961_0254353 Ga0466961_0254353_32_481 113
2 3300045836 Ga0466958_0275314 Ga0466958_0275314_57_506 113
3 3300044683 Ga0466965_0318929 Ga0466965_0318929_236_688 114
4 3300044684 Ga0466966_0199415 Ga0466966_0199415_668_1120 114
5 3300044706 Ga0466964_0047102 Ga0466964_0047102_451_903 114
6 3300044765 Ga0466970_0006353 Ga0466970_0006353_1837_2289 114
7 3300044842 Ga0466957_0105761 Ga0466957_0105761_539_991 114
8 3300053083 Ga0495655_0334254 Ga0495655_0334254_55_441 127
9 3300046663 Ga0495635_0541284 Ga0495635_0541284_15_404 129
10 3300049572 Ga0501036_0814808 Ga0501036_0814808_362_751 129
11 3300038443 Ga0395901_0673841 Ga0395901_0673841_626_1021 130
12 3300046681 Ga0495647_0287881 Ga0495647_0287881_46_450 131
13 3300046683 Ga0495658_0014222 Ga0495658_0014222_2037_2441 131
14 3300046683 Ga0495658_0284930 Ga0495658_0284930_103_507 131
15 3300047321 Ga0495676_0348939 Ga0495676_0348939_398_802 131
16 3300048925 Ga0496122_0000275 Ga0496122_0000275_91422_91832 133
17 3300048926 Ga0496123_0000166 Ga0496123_0000166_31597_32007 133
18 3300048927 Ga0496124_0001046 Ga0496124_0001046_41442_41852 133
19 3300041512 Ga0451853_3277386 Ga0451853_3277386_165_590 135
20 3300005329 Ga0070683_102106022 Ga0070683_1021060221 136
21 3300005338 Ga0068868_101444842 Ga0068868_1014448421 136
22 3300044901 Ga0466960_0035037 Ga0466960_0035037_153_563 136
23 iso_pu_bacteria 2643221617 2644098821 136
24 iso_pu_bacteria 2643221620 2644114702 136
25 iso_pu_bacteria 2738541305 2738869721 136
26 iso_pu_bacteria 2811994874 2812332436 136
27 3300041503 Ga0451847_0351324 Ga0451847_0351324_41_469 137
28 3300041494 Ga0451837_0723616 Ga0451837_0723616_62_499 138
29 3300044765 Ga0466970_0040094 Ga0466970_0040094_726_1175 138
30 3300005366 Ga0070659_100143802 Ga0070659_1001438023 139
31 3300005455 Ga0070663_100179246 Ga0070663_1001792463 139
32 3300005455 Ga0070663_101016197 Ga0070663_1010161972 139
33 3300005564 Ga0070664_100037838 Ga0070664_1000378382 139
34 3300009174 Ga0105241_10226729 Ga0105241_102267293 139
35 3300009545 Ga0105237_10344422 Ga0105237_103444222 139
36 3300010375 Ga0105239_10147141 Ga0105239_101471412 139
37 3300010375 Ga0105239_10258001 Ga0105239_102580012 139
38 3300011119 Ga0105246_10161329 Ga0105246_101613292 139
39 3300025920 Ga0207649_10246875 Ga0207649_102468752 139
40 3300025945 Ga0207679_10101901 Ga0207679_101019011 139
41 3300026067 Ga0207678_10207133 Ga0207678_102071331 139
42 3300026067 Ga0207678_10863621 Ga0207678_108636212 139
43 3300030744 Ga0316181_1131385 Ga0316181_11313854 139
44 3300032005 Ga0307411_10872529 Ga0307411_108725292 139
45 3300037471 Ga0395905_0013780 Ga0395905_0013780_4717_5148 139
46 3300038443 Ga0395901_0015246 Ga0395901_0015246_2018_2461 139
47 3300041486 Ga0451807_1193133 Ga0451807_1193133_936_1391 139
48 3300044658 Ga0466972_0003869 Ga0466972_0003869_5893_6357 139
49 3300044658 Ga0466972_0190232 Ga0466972_0190232_508_945 139
50 3300044684 Ga0466966_0711642 Ga0466966_0711642_25_462 139
51 3300044693 Ga0466961_0549950 Ga0466961_0549950_248_685 139
52 3300044694 Ga0466963_0098671 Ga0466963_0098671_190_627 139
53 3300044706 Ga0466964_0212299 Ga0466964_0212299_234_671 139
54 3300044719 Ga0466971_0022302 Ga0466971_0022302_1255_1692 139
55 3300044765 Ga0466970_0002238 Ga0466970_0002238_6310_6729 139
56 3300044765 Ga0466970_0004319 Ga0466970_0004319_1666_2103 139
57 3300044765 Ga0466970_0028468 Ga0466970_0028468_1111_1575 139
58 3300044765 Ga0466970_0041726 Ga0466970_0041726_818_1237 139
59 3300044765 Ga0466970_0076488 Ga0466970_0076488_355_783 139
60 3300044842 Ga0466957_0747879 Ga0466957_0747879_199_660 139
61 3300044901 Ga0466960_0040619 Ga0466960_0040619_1698_2117 139
62 3300045976 Ga0466967_0869887 Ga0466967_0869887_348_791 139
63 3300045976 Ga0466967_1599179 Ga0466967_1599179_12_443 139
64 3300048908 Ga0496105_0180634 Ga0496105_0180634_1242_1685 139
65 3300049570 Ga0501033_0881386 Ga0501033_0881386_80_523 139
66 3300049571 Ga0501034_1329436 Ga0501034_1329436_100_537 139
67 3300049575 Ga0501039_0073507 Ga0501039_0073507_204_647 139
68 3300049577 Ga0501041_0485641 Ga0501041_0485641_176_619 139
69 3300049577 Ga0501041_0876518 Ga0501041_0876518_91_543 139
70 3300049578 Ga0501042_0210862 Ga0501042_0210862_883_1335 139
71 3300049584 Ga0501068_1017389 Ga0501068_1017389_13_456 139
72 3300049586 Ga0501070_0018573 Ga0501070_0018573_3385_3822 139
73 3300049587 Ga0501071_0145090 Ga0501071_0145090_1300_1752 139
74 3300049588 Ga0501072_0059909 Ga0501072_0059909_224_676 139
75 3300049591 Ga0501075_0139227 Ga0501075_0139227_973_1416 139
76 3300049824 Ga0501045_0404995 Ga0501045_0404995_16_468 139
77 3300050492 nmdc:mga0yw44_2565_c1 nmdc:mga0yw44_2565_c1_3833_4273 139
78 3300050494 nmdc:mga06z11_5499_c1 nmdc:mga06z11_5499_c1_1194_1634 139
79 3300050496 nmdc:mga07m45_99733_c1 nmdc:mga07m45_99733_c1_240_677 139
80 3300061719 Ga0466962_0289000 Ga0466962_0289000_348_767 139
81 3300061734 Ga0530510_0574828 Ga0530510_0574828_238_690 139
82 iso_pu_bacteria 8054609563 8054611083 139
83 3300005335 Ga0070666_11052808 Ga0070666_110528081 140
84 3300005471 Ga0070698_100005020 Ga0070698_1000050208 140
85 3300005539 Ga0068853_102070538 Ga0068853_1020705381 140
86 3300006038 Ga0075365_10465363 Ga0075365_104653632 140
87 3300009176 Ga0105242_10467381 Ga0105242_104673812 140
88 3300009553 Ga0105249_10148202 Ga0105249_101482022 140
89 3300025934 Ga0207686_10766052 Ga0207686_107660522 140
90 3300025961 Ga0207712_10090082 Ga0207712_100900822 140
91 3300026041 Ga0207639_11872507 Ga0207639_118725071 140
92 3300037312 Ga0395899_0115554 Ga0395899_0115554_1111_1533 140
93 3300037418 Ga0395900_0396906 Ga0395900_0396906_897_1319 140
94 3300037466 Ga0395898_0195525 Ga0395898_0195525_1317_1742 140
95 3300038443 Ga0395901_0102110 Ga0395901_0102110_543_965 140
96 3300044658 Ga0466972_0247873 Ga0466972_0247873_227_655 140
97 3300044683 Ga0466965_0005453 Ga0466965_0005453_4198_4620 140
98 3300044683 Ga0466965_0014863 Ga0466965_0014863_2375_2815 140
99 3300044735 Ga0466968_0074731 Ga0466968_0074731_921_1367 140
100 3300044765 Ga0466970_0661445 Ga0466970_0661445_132_560 140
101 3300044901 Ga0466960_0001040 Ga0466960_0001040_6545_6976 140
102 3300044901 Ga0466960_0034330 Ga0466960_0034330_119_559 140
103 3300044901 Ga0466960_0888387 Ga0466960_0888387_46_498 140
104 3300045976 Ga0466967_0296378 Ga0466967_0296378_1078_1518 140
105 3300046529 Ga0495652_0665599 Ga0495652_0665599_63_515 140
106 3300049569 Ga0501032_0058851 Ga0501032_0058851_1688_2131 140
107 3300049571 Ga0501034_0033941 Ga0501034_0033941_4451_4894 140
108 3300049571 Ga0501034_1179991 Ga0501034_1179991_181_624 140
109 3300049572 Ga0501036_0005667 Ga0501036_0005667_7037_7480 140
110 3300049573 Ga0501037_0032979 Ga0501037_0032979_3007_3450 140
111 3300049574 Ga0501038_0001626 Ga0501038_0001626_8506_8949 140
112 3300049575 Ga0501039_1199115 Ga0501039_1199115_16_477 140
113 3300049576 Ga0501040_0886644 Ga0501040_0886644_162_620 140
114 3300049578 Ga0501042_0008017 Ga0501042_0008017_3968_4411 140
115 3300049580 Ga0501046_0110934 Ga0501046_0110934_1553_1996 140
116 3300049581 Ga0501047_0002734 Ga0501047_0002734_9462_9905 140
117 3300049587 Ga0501071_1584983 Ga0501071_1584983_23_481 140
118 3300049589 Ga0501073_0030181 Ga0501073_0030181_2452_2895 140
119 3300049590 Ga0501074_0670784 Ga0501074_0670784_250_693 140
120 3300049822 Ga0501035_0004295 Ga0501035_0004295_9249_9692 140
121 3300049823 Ga0501044_0007051 Ga0501044_0007051_3977_4420 140
122 3300050492 nmdc:mga0yw44_246145_c1 nmdc:mga0yw44_246145_c1_124_567 140
123 iso_pu_bacteria 2773857762 2774393333 140
124 iso_pu_bacteria 2808606439 2809195779 140
125 iso_pu_bacteria 2811994878 2812350678 140
126 3300005327 Ga0070658_10084679 Ga0070658_100846793 141
127 3300005339 Ga0070660_100008233 Ga0070660_1000082333 141
128 3300005366 Ga0070659_100021985 Ga0070659_1000219852 141
129 3300025904 Ga0207647_10011806 Ga0207647_100118065 141
130 3300025909 Ga0207705_10081427 Ga0207705_100814273 141
131 3300025919 Ga0207657_10010282 Ga0207657_100102825 141
132 3300025932 Ga0207690_10005067 Ga0207690_100050678 141
133 3300030732 Ga0316176_1126915 Ga0316176_11269152 141
134 3300030745 Ga0316182_1169616 Ga0316182_11696162 141
135 3300037418 Ga0395900_0256055 Ga0395900_0256055_305_742 141
136 3300044683 Ga0466965_0001666 Ga0466965_0001666_1926_2378 141
137 3300044684 Ga0466966_0226542 Ga0466966_0226542_414_866 141
138 3300044706 Ga0466964_0029602 Ga0466964_0029602_877_1329 141
139 3300044719 Ga0466971_0014217 Ga0466971_0014217_1679_2131 141
140 3300044735 Ga0466968_0077820 Ga0466968_0077820_431_883 141
141 3300044765 Ga0466970_0005591 Ga0466970_0005591_4795_5247 141
142 3300044842 Ga0466957_0001696 Ga0466957_0001696_5319_5771 141
143 3300045836 Ga0466958_0014844 Ga0466958_0014844_1651_2103 141
144 3300045976 Ga0466967_0021105 Ga0466967_0021105_4590_5042 141
145 3300045976 Ga0466967_1063814 Ga0466967_1063814_300_743 141
146 3300061719 Ga0466962_0004968 Ga0466962_0004968_2108_2560 141
147 iso_pu_bacteria 2891968417 2891971724 141
148 iso_pu_bacteria 2990256926 2990257472 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

67

144

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hmb-assembly1.cif.gz_A crystal structure of s. sahachiroi azig 0.9494 16 135
3r3c-assembly1.cif.gz_A crystal structure of arthrobacter sp. strain su 4-hydroxybenzoyl coa thioesterase mutant h64a complexed with 4-hydroxyphenacyl coa 0.9447 18 135
5ep5-assembly1.cif.gz_B the crystal structure of the hypothetical protein sav0944 mutant (glu47ala) from staphylococcus aureus. 0.9369 19 135
3s4k-assembly1.cif.gz_A structure of a putative esterase rv1847/mt1895 from mycobacterium tuberculosis 0.9368 17 135
4k4c-assembly1.cif.gz_D x-ray crystal structure of e. coli ybdb complexed with phenacyl-coa 0.9302 17 134
ID Description Score Start End Superfamily
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9411 17 135 3.10.129.10
3s4kB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9351 17 135 3.10.129.10
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9213 17 132 3.10.129.10
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9187 17 135 3.10.129.10
1sbkA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9166 14 135 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A6J7KQK4-F1-model_v4 Unannotated protein 0.9804 5 135 GO:0005829
GO:0061522
AF-A0A5Q0NS52-F1-model_v4 Hotdog fold thioesterase 0.9752 5 138 GO:0005829
GO:0061522
AF-A0A2A2D5L4-F1-model_v4 Thioesterase 0.975 23 135 GO:0005829
GO:0061522
AF-A0A4R8W5L7-F1-model_v4 Hotdog fold thioesterase 0.9749 23 134 GO:0005829
GO:0061522
AF-A0A401Y4M5-F1-model_v4 Thioesterase 0.9744 5 138 GO:0005829
GO:0061522

Feature Viewer

pLDDT pTM Quality
87.65 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map