F202722

General Info

Members Datasets Scaffolds Average Seq Length
148 112 296 167

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100402921|Ga0068858_1004029212
Length 174
Sequence MDADSTPPEIQLVCPDSLSLLDATREIFREYAEGLGIDLLAFQNFDAELAELPGAYAAPSGHLLLALVDGELAGCGALRALTDVDQANACEMKRLYVRPAFRRFGLGRLLAEALLDEARRAGYSVLLLDTLDDMEAARGLYASLGFVETAPYYYNPIPGAHYLKVELDASTSRY

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
23 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
24 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
25 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
26 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
27 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
38 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
39 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
40 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
41 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
42 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
43 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
44 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
45 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
46 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
47 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
48 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
49 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
50 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
51 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
52 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
53 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
54 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
58 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
59 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
60 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
61 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
62 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
63 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
64 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
65 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
66 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
67 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
68 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
69 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
77 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
78 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
79 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
80 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
81 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
82 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
83 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
84 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
89 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
90 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
91 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
92 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
93 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
94 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
95 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
96 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
97 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
98 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
101 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
102 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
103 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
104 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
105 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
106 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
107 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
108 2643221585 Pelomonas sp. Root662 Isolate Unclassified
109 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
110 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
111 2643221656 Pelomonas sp. Root405 Isolate Unclassified
112 2643221660 Methylibium sp. Root1272 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.95
Metatranscriptomes 0
Isolates 4.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.49
Nodule 0
Rhizoplane 1.35
Rhizosphere 70.27
Stem 0
Stem Tuber 0
Unclassified 4.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100402921 3300005842 Bacteria 1315
2 rootH1_10007122 3300003316 Bacteria 10368
3 rootL2_10002735 3300003322 Bacteria 2190
4 rootL2_10015797 3300003322 Bacteria 10365
5 rootL2_10071441 3300003322 Bacteria 5733
6 rootH1_10011384 3300003323 Bacteria 6100
7 Ga0055540_1006695 3300003792 Bacteria 4517
8 Ga0055531_10000010 3300003794 Bacteria 206117
9 Ga0070683_101266733 3300005329 Unclassified 709
10 Ga0068867_100304879 3300005459 Bacteria 1314
11 Ga0070706_100040886 3300005467 Unclassified 4280
12 Ga0070698_100000568 3300005471 Bacteria 39606
13 Ga0070698_100484723 3300005471 Bacteria 1174
14 Ga0070699_100916758 3300005518 Unclassified 803
15 Ga0070684_100277082 3300005535 Bacteria 1536
16 Ga0070697_100015253 3300005536 Bacteria 6030
17 Ga0070693_100448667 3300005547 Unclassified 905
18 Ga0081539_10000110 3300005985 Bacteria 190555
19 Ga0081539_10185929 3300005985 Bacteria 971
20 Ga0075366_10055204 3300006195 Bacteria 2359
21 Ga0075366_10088391 3300006195 Bacteria 1855
22 Ga0075370_10112251 3300006353 Bacteria 1583
23 Ga0075370_10235567 3300006353 Bacteria 1084
24 Ga0075434_100149673 3300006871 Bacteria 2354
25 Ga0105240_10481845 3300009093 Bacteria 1383
26 Ga0105243_10058663 3300009148 Bacteria 3068
27 Ga0105237_10826671 3300009545 Bacteria 933
28 Ga0163163_11633120 3300014325 Unclassified 705
29 Ga0157380_10203677 3300014326 Bacteria 1758
30 Ga0157380_10897529 3300014326 Bacteria 912
31 Ga0157379_10029711 3300014968 Bacteria 4860
32 Ga0213872_10002620 3300021361 Bacteria 10455
33 Ga0213874_10091647 3300021377 Bacteria 999
34 Ga0209051_1002683 3300025303 Bacteria 12433
35 Ga0209051_1015759 3300025303 Bacteria 3463
36 Ga0209257_1000033 3300025304 Bacteria 671006
37 Ga0209257_1074992 3300025304 Bacteria 882
38 Ga0207684_10002053 3300025910 Bacteria 20730
39 Ga0207690_10241743 3300025932 Bacteria 1391
40 Ga0207709_10032197 3300025935 Bacteria 3068
41 Ga0207661_11486180 3300025944 Bacteria 621
42 Ga0207658_10106418 3300025986 Bacteria 2208
43 Ga0207639_10311533 3300026041 Bacteria 1394
44 Ga0207648_10200293 3300026089 Bacteria 1770
45 Ga0268264_10250326 3300028381 Bacteria 1646
46 Ga0307515_10035511 3300028794 Bacteria 8106
47 Ga0307515_10404694 3300028794 Bacteria 989
48 Ga0265324_10042827 3300029957 Bacteria 1564
49 Ga0307509_10174454 3300031507 Bacteria 2024
50 Ga0307408_100000016 3300031548 Bacteria 356896
51 Ga0307508_10570426 3300031616 Bacteria 731
52 Ga0307516_10001199 3300031730 Bacteria 36246
53 Ga0307516_10020978 3300031730 Bacteria 6740
54 Ga0307516_10302812 3300031730 Bacteria 1274
55 Ga0307516_10424170 3300031730 Bacteria 988
56 Ga0307412_10191718 3300031911 Bacteria 1546
57 Ga0307412_11153316 3300031911 Bacteria 692
58 Ga0307409_100084679 3300031995 Bacteria 2575
59 Ga0307416_100066527 3300032002 Bacteria 2967
60 Ga0307414_10132335 3300032004 Bacteria 1938
61 Ga0307411_10048986 3300032005 Bacteria 2742
62 Ga0373950_0016073 3300034818 Bacteria 1276
63 Ga0373958_0012773 3300034819 Bacteria 1442
64 Ga0373959_0069363 3300034820 Bacteria 794
65 Ga0373940_0027071 3300035088 Bacteria 1504
66 Ga0373939_0000382 3300035114 Bacteria 11170
67 Ga0373960_0003008 3300035121 Bacteria 3811
68 Ga0373931_0000817 3300035691 Bacteria 13060
69 Ga0373931_0001867 3300035691 Bacteria 9187
70 Ga0373931_0918821 3300035691 Bacteria 589
71 Ga0395898_0142472 3300037466 Bacteria 2295
72 Ga0395905_0000948 3300037471 Bacteria 37225
73 Ga0395905_0003615 3300037471 Bacteria 16431
74 Ga0395905_0009796 3300037471 Bacteria 9340
75 Ga0395905_0056881 3300037471 Bacteria 3658
76 Ga0395905_0847105 3300037471 Bacteria 817
77 Ga0436361_0429153 3300039447 Bacteria 60016
78 Ga0436363_0778745 3300039450 Bacteria 3327
79 Ga0451802_0094948 3300041460 Bacteria 1031
80 Ga0451807_1607206 3300041486 Bacteria 632
81 Ga0439437_008895 3300042000 Bacteria 1134
82 Ga0439445_0110057 3300042004 Bacteria 786
83 Ga0439455_0037120 3300042012 Bacteria 1235
84 Ga0450888_001612 3300042126 Bacteria 2173
85 Ga0450891_000032 3300042129 Bacteria 9877
86 Ga0450892_002154 3300042130 Bacteria 1718
87 Ga0450902_023186 3300042137 Bacteria 1030
88 Ga0439458_0053692 3300042157 Bacteria 997
89 Ga0439458_0055326 3300042157 Bacteria 984
90 Ga0450893_0007675 3300042532 Bacteria 1753
91 Ga0451577_0003923 3300042876 Bacteria 16072
92 Ga0451577_0013656 3300042876 Bacteria 7594
93 Ga0453683_0135838 3300044673 Bacteria 1551
94 Ga0466965_0057877 3300044683 Bacteria 1932
95 Ga0453684_0088369 3300044712 Bacteria 3838
96 Ga0453684_0114391 3300044712 Bacteria 3271
97 Ga0453684_0171881 3300044712 Bacteria 2553
98 Ga0453684_0446247 3300044712 Bacteria 1441
99 Ga0466960_0058250 3300044901 Bacteria 1886
100 Ga0466960_0076241 3300044901 Bacteria 1679
101 Ga0451576_0079943 3300045051 Bacteria 3402
102 Ga0451576_0098904 3300045051 Bacteria 3034
103 Ga0451576_0450462 3300045051 Bacteria 1351
104 Ga0451576_2215540 3300045051 Bacteria 564
105 Ga0495590_0006802 3300046457 Bacteria 4444
106 Ga0495650_0004978 3300046471 Bacteria 8859
107 Ga0495585_0068910 3300046492 Bacteria 1931
108 Ga0495660_0018456 3300046810 Bacteria 4011
109 Ga0495681_0167860 3300047470 Bacteria 910
110 Ga0496121_0007574 3300048924 Bacteria 13071
111 Ga0496124_0000458 3300048927 Bacteria 70719
112 Ga0496124_0203130 3300048927 Bacteria 1505
113 Ga0496125_0006008 3300048928 Bacteria 13291
114 Ga0501037_0089342 3300049573 Bacteria 2229
115 Ga0501046_0000030 3300049580 Bacteria 187803
116 Ga0501047_0000049 3300049581 Bacteria 162513
117 Ga0501048_0002730 3300049582 Bacteria 13470
118 Ga0501211_000894 3300049658 Bacteria 3119
119 Ga0501222_015047 3300049662 Bacteria 1022
120 Ga0501227_011177 3300049665 Bacteria 1954
121 Ga0501221_041139 3300049704 Bacteria 1008
122 Ga0501229_008652 3300049706 Bacteria 1273
123 Ga0501083_0247304 3300049744 Bacteria 1161
124 Ga0501262_012279 3300049759 Bacteria 1094
125 Ga0501265_006083 3300049762 Bacteria 1401
126 Ga0501268_065050 3300049765 Bacteria 729
127 Ga0501272_018764 3300049769 Bacteria 821
128 Ga0501035_0085607 3300049822 Bacteria 2778
129 Ga0501044_0213060 3300049823 Bacteria 1885
130 Ga0501045_0006360 3300049824 Bacteria 8176
131 nmdc:mga0k408_101312_c1 3300050493 Bacteria 1287
132 nmdc:mga0k408_114335_c1 3300050493 Bacteria 1596
133 nmdc:mga0k408_348541_c1 3300050493 Bacteria 883
134 nmdc:mga0k408_52991_c1 3300050493 Bacteria 2351
135 nmdc:mga07m45_34397_c1 3300050496 Bacteria 2816
136 nmdc:mga07m45_48210_c1 3300050496 Bacteria 2395
137 nmdc:mga07m45_9383_c1 3300050496 Bacteria 5074
138 nmdc:mga0n895_103713_c1 3300050512 Bacteria 2855
139 nmdc:mga0n895_848491_c1 3300050512 Bacteria 901
140 nmdc:mga0rr50_1263723_c1 3300050513 Unclassified 626
141 nmdc:mga08x19_275490_c1 3300050514 Bacteria 1165
142 Ga0501082_0572735 3300060353 Bacteria 988
143 2643741970 2643221544 Bacteria 5886209
144 2643934109 2643221585 Bacteria 5812563
145 2644220166 2643221639 Bacteria 6649903
146 2644261204 2643221646 Bacteria 6433402
147 2644315596 2643221656 Bacteria 5809961
148 2644339708 2643221660 Bacteria 4208257
149 Ga0068858_100402921
150 rootH1_10007122
151 rootL2_10002735
152 rootL2_10015797
153 rootL2_10071441
154 rootH1_10011384
155 Ga0055540_1006695
156 Ga0055531_10000010
157 Ga0070683_101266733
158 Ga0068867_100304879
159 Ga0070706_100040886
160 Ga0070698_100000568
161 Ga0070698_100484723
162 Ga0070699_100916758
163 Ga0070684_100277082
164 Ga0070697_100015253
165 Ga0070693_100448667
166 Ga0081539_10000110
167 Ga0081539_10185929
168 Ga0075366_10055204
169 Ga0075366_10088391
170 Ga0075370_10112251
171 Ga0075370_10235567
172 Ga0075434_100149673
173 Ga0105240_10481845
174 Ga0105243_10058663
175 Ga0105237_10826671
176 Ga0163163_11633120
177 Ga0157380_10203677
178 Ga0157380_10897529
179 Ga0157379_10029711
180 Ga0213872_10002620
181 Ga0213874_10091647
182 Ga0209051_1002683
183 Ga0209051_1015759
184 Ga0209257_1000033
185 Ga0209257_1074992
186 Ga0207684_10002053
187 Ga0207690_10241743
188 Ga0207709_10032197
189 Ga0207661_11486180
190 Ga0207658_10106418
191 Ga0207639_10311533
192 Ga0207648_10200293
193 Ga0268264_10250326
194 Ga0307515_10035511
195 Ga0307515_10404694
196 Ga0265324_10042827
197 Ga0307509_10174454
198 Ga0307408_100000016
199 Ga0307508_10570426
200 Ga0307516_10001199
201 Ga0307516_10020978
202 Ga0307516_10302812
203 Ga0307516_10424170
204 Ga0307412_10191718
205 Ga0307412_11153316
206 Ga0307409_100084679
207 Ga0307416_100066527
208 Ga0307414_10132335
209 Ga0307411_10048986
210 Ga0373950_0016073
211 Ga0373958_0012773
212 Ga0373959_0069363
213 Ga0373940_0027071
214 Ga0373939_0000382
215 Ga0373960_0003008
216 Ga0373931_0000817
217 Ga0373931_0001867
218 Ga0373931_0918821
219 Ga0395898_0142472
220 Ga0395905_0000948
221 Ga0395905_0003615
222 Ga0395905_0009796
223 Ga0395905_0056881
224 Ga0395905_0847105
225 Ga0436361_0429153
226 Ga0436363_0778745
227 Ga0451802_0094948
228 Ga0451807_1607206
229 Ga0439437_008895
230 Ga0439445_0110057
231 Ga0439455_0037120
232 Ga0450888_001612
233 Ga0450891_000032
234 Ga0450892_002154
235 Ga0450902_023186
236 Ga0439458_0053692
237 Ga0439458_0055326
238 Ga0450893_0007675
239 Ga0451577_0003923
240 Ga0451577_0013656
241 Ga0453683_0135838
242 Ga0466965_0057877
243 Ga0453684_0088369
244 Ga0453684_0114391
245 Ga0453684_0171881
246 Ga0453684_0446247
247 Ga0466960_0058250
248 Ga0466960_0076241
249 Ga0451576_0079943
250 Ga0451576_0098904
251 Ga0451576_0450462
252 Ga0451576_2215540
253 Ga0495590_0006802
254 Ga0495650_0004978
255 Ga0495585_0068910
256 Ga0495660_0018456
257 Ga0495681_0167860
258 Ga0496121_0007574
259 Ga0496124_0000458
260 Ga0496124_0203130
261 Ga0496125_0006008
262 Ga0501037_0089342
263 Ga0501046_0000030
264 Ga0501047_0000049
265 Ga0501048_0002730
266 Ga0501211_000894
267 Ga0501222_015047
268 Ga0501227_011177
269 Ga0501221_041139
270 Ga0501229_008652
271 Ga0501083_0247304
272 Ga0501262_012279
273 Ga0501265_006083
274 Ga0501268_065050
275 Ga0501272_018764
276 Ga0501035_0085607
277 Ga0501044_0213060
278 Ga0501045_0006360
279 nmdc:mga0k408_101312_c1
280 nmdc:mga0k408_114335_c1
281 nmdc:mga0k408_348541_c1
282 nmdc:mga0k408_52991_c1
283 nmdc:mga07m45_34397_c1
284 nmdc:mga07m45_48210_c1
285 nmdc:mga07m45_9383_c1
286 nmdc:mga0n895_103713_c1
287 nmdc:mga0n895_848491_c1
288 nmdc:mga0rr50_1263723_c1
289 nmdc:mga08x19_275490_c1
290 Ga0501082_0572735
291 2643741970
292 2643934109
293 2644220166
294 2644261204
295 2644315596
296 2644339708

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

74

154

0.87

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

33

156

0.86

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

21

146

0.83

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

59

148

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c26-assembly1.cif.gz_A-2 crystal structure of a putative acetyltransferase (np_394282.1) from thermoplasma acidophilum at 2.00 a resolution 0.8745 58 144
5i0c-assembly1.cif.gz_A crystal structure of predicted acyltransferase yjdj with acyl-coa n-acyltransferase domain from escherichia coli str. k-12 0.857 58 123
4ava-assembly1.cif.gz_A crystal structure of protein lysine acetyltransferase rv0998 from mycobacterium tuberculosis 0.8496 51 161
4avc-assembly1.cif.gz_A crystal structure of protein lysine acetyltransferase rv0998 in complex with acetyl coa and camp 0.8415 55 168
7ypu-assembly2.cif.gz_D orfe-coa-glycylthricin complex 0.8276 55 161
ID Description Score Start End Superfamily
af_O94340_9_162_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9616 9 162 3.40.630.30
af_O94340_9_162_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9434 9 162 3.40.630.30
af_P39337_13_151_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8777 12 146 3.40.630.30
af_Q94AC8_62_254_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8648 66 146 3.40.630.30
af_A0A286YBP0_57_178_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8551 36 150 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7X6DJD9-F1-model_v4 GNAT family N-acetyltransferase 0.997 4 162 GO:0016747
AF-A0A1H7JTG1-F1-model_v4 Ribosomal protein S18 acetylase RimI 0.9962 9 162 GO:0005840
GO:0016747
AF-A0A0Q5ZHX2-F1-model_v4 GCN5 family acetyltransferase 0.996 9 162 GO:0016747
AF-A0A7V7XBS3-F1-model_v4 deleted 0.9955 62 161
AF-A0A1S8FH99-F1-model_v4 GNAT family N-acetyltransferase 0.9946 1 162 GO:0016747

Map