F202615

General Info

Members Datasets Scaffolds Average Seq Length
148 108 148 116

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100629085|Ga0068853_1006290852
Length 126
Sequence MIGTRPVWRFMTGFRRGDVVLVLFPNSDLITFKRRPALVVEADDLNTGLPQIVIAMITSNLARRGHPSRVFIPLNSHAWKGSGLLTDSVIMADNLATTLNKAIVEKLGRLADMKPIDAALRTTLAL

Samples

Sample ID Description Type Environment
1 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
80 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
81 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
82 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
83 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
84 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
85 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
86 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
87 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
94 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
95 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
96 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
97 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
98 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
101 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
102 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
103 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
104 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
105 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
107 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
108 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.35
Nodule 0
Rhizoplane 2.03
Rhizosphere 95.27
Stem 0
Stem Tuber 0
Unclassified 1.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1005059 3300000545 Unclassified 934
2 LJQas_1000129 3300000549 Bacteria 13209
3 LJQas_1000175 3300000549 Bacteria 11452
4 JGI25405J52794_10075829 3300003911 Unclassified 737
5 Ga0058860_11709064 3300004801 Bacteria 640
6 Ga0065704_10649237 3300005289 Unclassified 565
7 Ga0065712_10025403 3300005290 Bacteria 1368
8 Ga0065707_10761808 3300005295 Bacteria 614
9 Ga0070676_10419933 3300005328 Bacteria 934
10 Ga0070690_100525379 3300005330 Bacteria 889
11 Ga0070666_10647246 3300005335 Bacteria 773
12 Ga0070680_100346796 3300005336 Unclassified 1262
13 Ga0070680_101493356 3300005336 Bacteria 585
14 Ga0070689_101141535 3300005340 Bacteria 698
15 Ga0070661_100166961 3300005344 Bacteria 1670
16 Ga0070669_101132624 3300005353 Unclassified 674
17 Ga0070671_100123156 3300005355 Bacteria 2183
18 Ga0070688_100161088 3300005365 Bacteria 1541
19 Ga0070659_100460637 3300005366 Bacteria 1080
20 Ga0070714_100005431 3300005435 Bacteria 9726
21 Ga0070714_100483561 3300005435 Unclassified 1179
22 Ga0070705_100331576 3300005440 Unclassified 1102
23 Ga0070700_100364879 3300005441 Unclassified 1075
24 Ga0070700_101620455 3300005441 Unclassified 553
25 Ga0070708_100274266 3300005445 Unclassified 1586
26 Ga0070708_100810052 3300005445 Bacteria 880
27 Ga0070706_100136512 3300005467 Bacteria 2289
28 Ga0070706_100208572 3300005467 Bacteria 1824
29 Ga0070698_100370309 3300005471 Bacteria 1364
30 Ga0070699_100062559 3300005518 Bacteria 3226
31 Ga0070699_100114421 3300005518 Bacteria 2370
32 Ga0070684_100691831 3300005535 Bacteria 950
33 Ga0070697_100610015 3300005536 Bacteria 959
34 Ga0068853_100629085 3300005539 Unclassified 1020
35 Ga0070696_100006305 3300005546 Bacteria 7943
36 Ga0070665_100003235 3300005548 Bacteria 17502
37 Ga0070665_100514293 3300005548 Bacteria 1209
38 Ga0070704_101250495 3300005549 Unclassified 678
39 Ga0070702_100802068 3300005615 Unclassified 728
40 Ga0068870_10273282 3300005840 Unclassified 1056
41 Ga0068860_100120861 3300005843 Bacteria 2508
42 Ga0081455_10000918 3300005937 Bacteria 37873
43 Ga0075364_10054318 3300006051 Bacteria 2619
44 Ga0070712_100180904 3300006175 Bacteria 1643
45 Ga0075427_10010274 3300006194 Unclassified 1400
46 Ga0075428_100052257 3300006844 Unclassified 4479
47 Ga0075428_100246420 3300006844 Bacteria 1926
48 Ga0075430_100551294 3300006846 Bacteria 951
49 Ga0075431_100193123 3300006847 Bacteria 2085
50 Ga0075431_100805246 3300006847 Bacteria 912
51 Ga0075433_10121663 3300006852 Unclassified 2318
52 Ga0075433_10513551 3300006852 Unclassified 1054
53 Ga0075434_101271064 3300006871 Unclassified 747
54 Ga0075429_100021173 3300006880 Bacteria 5637
55 Ga0075429_100064140 3300006880 Bacteria 3200
56 Ga0075429_100869780 3300006880 Unclassified 789
57 Ga0099794_10020426 3300007265 Bacteria 2997
58 Ga0105240_10030793 3300009093 Bacteria 6970
59 Ga0111539_10172563 3300009094 Bacteria 2526
60 Ga0111539_12259632 3300009094 Unclassified 631
61 Ga0114129_10140079 3300009147 Bacteria 3317
62 Ga0114129_10150206 3300009147 Bacteria 3188
63 Ga0114129_10250723 3300009147 Unclassified 2376
64 Ga0114129_10656707 3300009147 Unclassified 1353
65 Ga0105243_10829867 3300009148 Bacteria 914
66 Ga0105241_10305930 3300009174 Bacteria 1366
67 Ga0105242_11409732 3300009176 Unclassified 724
68 Ga0105249_10195103 3300009553 Bacteria 1978
69 Ga0105239_10875307 3300010375 Bacteria 1031
70 Ga0105239_12604900 3300010375 Unclassified 590
71 Ga0105246_11603519 3300011119 Unclassified 615
72 Ga0157373_10549241 3300013100 Unclassified 838
73 Ga0157369_10187368 3300013105 Unclassified 2175
74 Ga0157369_12263028 3300013105 Unclassified 551
75 Ga0157374_10234001 3300013296 Bacteria 1805
76 Ga0157378_10253934 3300013297 Bacteria 1684
77 Ga0157378_10604968 3300013297 Bacteria 1108
78 Ga0163162_11814363 3300013306 Unclassified 697
79 Ga0157372_10057789 3300013307 Unclassified 4337
80 Ga0157375_10361151 3300013308 Bacteria 1618
81 Ga0157375_11963271 3300013308 Unclassified 695
82 Ga0157377_10569207 3300014745 Unclassified 803
83 Ga0207697_10036840 3300025315 Bacteria 2004
84 Ga0207684_10183914 3300025910 Unclassified 1802
85 Ga0207684_10619672 3300025910 Unclassified 923
86 Ga0207654_10118711 3300025911 Bacteria 1657
87 Ga0207693_10222548 3300025915 Bacteria 1482
88 Ga0207660_10834658 3300025917 Bacteria 752
89 Ga0207649_10146826 3300025920 Bacteria 1620
90 Ga0207646_10782335 3300025922 Unclassified 850
91 Ga0207687_10047274 3300025927 Bacteria 2982
92 Ga0207664_10008787 3300025929 Bacteria 7066
93 Ga0207709_10338221 3300025935 Bacteria 1132
94 Ga0207670_10133293 3300025936 Bacteria 1823
95 Ga0207708_10977569 3300026075 Unclassified 735
96 Ga0207708_11549622 3300026075 Unclassified 582
97 Ga0207428_10369554 3300027907 Bacteria 1053
98 Ga0268266_10002927 3300028379 Bacteria 17658
99 Ga0268266_10316174 3300028379 Bacteria 1460
100 Ga0268264_10099620 3300028381 Bacteria 2522
101 Ga0395905_0004273 3300037471 Bacteria 14901
102 Ga0395905_0028109 3300037471 Bacteria 5302
103 Ga0395905_0618730 3300037471 Bacteria 985
104 Ga0395905_1243972 3300037471 Unclassified 648
105 Ga0395901_0123086 3300038443 Bacteria 2726
106 Ga0395901_0231643 3300038443 Bacteria 1928
107 Ga0395901_1680106 3300038443 Unclassified 587
108 Ga0400489_38610 3300039093 Bacteria 1210
109 Ga0436360_0560603 3300039438 Unclassified 577
110 Ga0439440_0110609 3300042993 Unclassified 756
111 Ga0495657_0433018 3300046675 Unclassified 771
112 Ga0495613_0688064 3300046689 Unclassified 674
113 Ga0496107_1074569 3300048910 Bacteria 582
114 Ga0496112_0354627 3300048915 Bacteria 1409
115 Ga0496114_1539707 3300048917 Bacteria 553
116 Ga0501031_0932085 3300049568 Unclassified 556
117 Ga0501036_0739356 3300049572 Bacteria 812
118 Ga0501038_0571799 3300049574 Bacteria 858
119 Ga0501040_1373188 3300049576 Unclassified 513
120 Ga0501041_0759593 3300049577 Bacteria 621
121 Ga0501042_1285339 3300049578 Bacteria 533
122 Ga0501068_0518043 3300049584 Bacteria 774
123 Ga0501072_0466232 3300049588 Bacteria 1000
124 Ga0501074_0565732 3300049590 Bacteria 804
125 Ga0501075_0183401 3300049591 Bacteria 1597
126 Ga0501075_1281678 3300049591 Bacteria 555
127 Ga0501076_0575028 3300049592 Bacteria 929
128 Ga0501079_1618844 3300049741 Unclassified 509
129 Ga0501080_0029092 3300049742 Bacteria 5143
130 Ga0501080_0168850 3300049742 Bacteria 2018
131 Ga0501081_0506447 3300049743 Bacteria 900
132 Ga0501045_0700355 3300049824 Bacteria 747
133 nmdc:mga00v17_381984_c1 3300050491 Bacteria 916
134 nmdc:mga05p37_254718_c1 3300050507 Unclassified 2104
135 nmdc:mga05p37_455_c1 3300050507 Bacteria 44549
136 nmdc:mga05p37_566257_c1 3300050507 Unclassified 1290
137 nmdc:mga05p37_878808_c1 3300050507 Bacteria 970
138 nmdc:mga09592_1154511_c1 3300050508 Unclassified 642
139 nmdc:mga09592_160031_c1 3300050508 Bacteria 1945
140 nmdc:mga09592_1719568_c1 3300050508 Unclassified 505
141 nmdc:mga06r32_227529_c1 3300050510 Bacteria 1853
142 nmdc:mga06r32_300783_c1 3300050510 Bacteria 1590
143 nmdc:mga08y16_1076547_c1 3300050511 Bacteria 780
144 nmdc:mga08y16_933352_c1 3300050511 Unclassified 852
145 nmdc:mga0n895_1590157_c1 3300050512 Unclassified 618
146 Ga0530510_0167746 3300061734 Unclassified 1626
147 Ga0530510_0414330 3300061734 Bacteria 1016
148 Ga0530510_1470244 3300061734 Bacteria 523

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10150206 Ga0114129_101502063 101
2 3300050507 nmdc:mga05p37_254718_c1 nmdc:mga05p37_254718_c1_1410_1727 101
3 3300050508 nmdc:mga09592_1719568_c1 nmdc:mga09592_1719568_c1_40_360 102
4 3300009176 Ga0105242_11409732 Ga0105242_114097322 104
5 3300013308 Ga0157375_11963271 Ga0157375_119632711 104
6 3300005441 Ga0070700_101620455 Ga0070700_1016204552 105
7 3300005615 Ga0070702_100802068 Ga0070702_1008020681 105
8 3300013306 Ga0163162_11814363 Ga0163162_118143632 105
9 3300039093 Ga0400489_38610 Ga0400489_38610_637_954 105
10 3300050511 nmdc:mga08y16_933352_c1 nmdc:mga08y16_933352_c1_255_572 105
11 3300013105 Ga0157369_12263028 Ga0157369_122630282 106
12 3300009147 Ga0114129_10656707 Ga0114129_106567072 107
13 3300014745 Ga0157377_10569207 Ga0157377_105692072 107
14 3300049590 Ga0501074_0565732 Ga0501074_0565732_11_334 107
15 3300005445 Ga0070708_100810052 Ga0070708_1008100521 109
16 3300007265 Ga0099794_10020426 Ga0099794_100204264 110
17 3300006051 Ga0075364_10054318 Ga0075364_100543185 111
18 3300050491 nmdc:mga00v17_381984_c1 nmdc:mga00v17_381984_c1_285_638 111
19 3300009147 Ga0114129_10140079 Ga0114129_101400793 112
20 3300010375 Ga0105239_12604900 Ga0105239_126049001 112
21 3300050507 nmdc:mga05p37_455_c1 nmdc:mga05p37_455_c1_34234_34578 112
22 3300005295 Ga0065707_10761808 Ga0065707_107618081 114
23 3300005441 Ga0070700_100364879 Ga0070700_1003648792 114
24 3300005548 Ga0070665_100003235 Ga0070665_1000032353 114
25 3300026075 Ga0207708_10977569 Ga0207708_109775692 114
26 3300028379 Ga0268266_10002927 Ga0268266_1000292718 114
27 3300039438 Ga0436360_0560603 Ga0436360_0560603_48_392 114
28 3300003911 JGI25405J52794_10075829 JGI25405J52794_100758292 115
29 3300004801 Ga0058860_11709064 Ga0058860_117090642 115
30 3300005289 Ga0065704_10649237 Ga0065704_106492371 115
31 3300005290 Ga0065712_10025403 Ga0065712_100254033 115
32 3300005328 Ga0070676_10419933 Ga0070676_104199331 115
33 3300005330 Ga0070690_100525379 Ga0070690_1005253792 115
34 3300005335 Ga0070666_10647246 Ga0070666_106472462 115
35 3300005336 Ga0070680_101493356 Ga0070680_1014933562 115
36 3300005340 Ga0070689_101141535 Ga0070689_1011415352 115
37 3300005344 Ga0070661_100166961 Ga0070661_1001669611 115
38 3300005353 Ga0070669_101132624 Ga0070669_1011326242 115
39 3300005355 Ga0070671_100123156 Ga0070671_1001231564 115
40 3300005365 Ga0070688_100161088 Ga0070688_1001610883 115
41 3300005366 Ga0070659_100460637 Ga0070659_1004606372 115
42 3300005435 Ga0070714_100005431 Ga0070714_1000054315 115
43 3300005435 Ga0070714_100483561 Ga0070714_1004835611 115
44 3300005440 Ga0070705_100331576 Ga0070705_1003315763 115
45 3300005445 Ga0070708_100274266 Ga0070708_1002742663 115
46 3300005467 Ga0070706_100136512 Ga0070706_1001365122 115
47 3300005467 Ga0070706_100208572 Ga0070706_1002085721 115
48 3300005471 Ga0070698_100370309 Ga0070698_1003703091 115
49 3300005518 Ga0070699_100062559 Ga0070699_1000625593 115
50 3300005518 Ga0070699_100114421 Ga0070699_1001144212 115
51 3300005535 Ga0070684_100691831 Ga0070684_1006918312 115
52 3300005536 Ga0070697_100610015 Ga0070697_1006100152 115
53 3300005546 Ga0070696_100006305 Ga0070696_1000063056 115
54 3300005548 Ga0070665_100514293 Ga0070665_1005142932 115
55 3300005549 Ga0070704_101250495 Ga0070704_1012504952 115
56 3300005840 Ga0068870_10273282 Ga0068870_102732822 115
57 3300005843 Ga0068860_100120861 Ga0068860_1001208613 115
58 3300005937 Ga0081455_10000918 Ga0081455_1000091815 115
59 3300006175 Ga0070712_100180904 Ga0070712_1001809041 115
60 3300006194 Ga0075427_10010274 Ga0075427_100102742 115
61 3300006844 Ga0075428_100052257 Ga0075428_1000522573 115
62 3300006844 Ga0075428_100246420 Ga0075428_1002464202 115
63 3300006846 Ga0075430_100551294 Ga0075430_1005512942 115
64 3300006847 Ga0075431_100193123 Ga0075431_1001931232 115
65 3300006847 Ga0075431_100805246 Ga0075431_1008052462 115
66 3300006852 Ga0075433_10121663 Ga0075433_101216633 115
67 3300006852 Ga0075433_10513551 Ga0075433_105135513 115
68 3300006871 Ga0075434_101271064 Ga0075434_1012710642 115
69 3300006880 Ga0075429_100021173 Ga0075429_1000211736 115
70 3300006880 Ga0075429_100064140 Ga0075429_1000641403 115
71 3300006880 Ga0075429_100869780 Ga0075429_1008697802 115
72 3300009094 Ga0111539_10172563 Ga0111539_101725632 115
73 3300009094 Ga0111539_12259632 Ga0111539_122596321 115
74 3300009147 Ga0114129_10250723 Ga0114129_102507232 115
75 3300009148 Ga0105243_10829867 Ga0105243_108298672 115
76 3300009174 Ga0105241_10305930 Ga0105241_103059301 115
77 3300009553 Ga0105249_10195103 Ga0105249_101951032 115
78 3300010375 Ga0105239_10875307 Ga0105239_108753072 115
79 3300011119 Ga0105246_11603519 Ga0105246_116035192 115
80 3300013105 Ga0157369_10187368 Ga0157369_101873683 115
81 3300013296 Ga0157374_10234001 Ga0157374_102340012 115
82 3300013297 Ga0157378_10253934 Ga0157378_102539343 115
83 3300013297 Ga0157378_10604968 Ga0157378_106049681 115
84 3300013307 Ga0157372_10057789 Ga0157372_100577892 115
85 3300013308 Ga0157375_10361151 Ga0157375_103611514 115
86 3300025315 Ga0207697_10036840 Ga0207697_100368404 115
87 3300025910 Ga0207684_10183914 Ga0207684_101839143 115
88 3300025910 Ga0207684_10619672 Ga0207684_106196722 115
89 3300025911 Ga0207654_10118711 Ga0207654_101187112 115
90 3300025915 Ga0207693_10222548 Ga0207693_102225481 115
91 3300025917 Ga0207660_10834658 Ga0207660_108346582 115
92 3300025920 Ga0207649_10146826 Ga0207649_101468262 115
93 3300025922 Ga0207646_10782335 Ga0207646_107823352 115
94 3300025927 Ga0207687_10047274 Ga0207687_100472742 115
95 3300025929 Ga0207664_10008787 Ga0207664_100087874 115
96 3300025935 Ga0207709_10338221 Ga0207709_103382212 115
97 3300025936 Ga0207670_10133293 Ga0207670_101332934 115
98 3300026075 Ga0207708_11549622 Ga0207708_115496222 115
99 3300027907 Ga0207428_10369554 Ga0207428_103695541 115
100 3300028379 Ga0268266_10316174 Ga0268266_103161742 115
101 3300028381 Ga0268264_10099620 Ga0268264_100996203 115
102 3300037471 Ga0395905_0004273 Ga0395905_0004273_6703_7074 115
103 3300037471 Ga0395905_0618730 Ga0395905_0618730_352_699 115
104 3300038443 Ga0395901_0231643 Ga0395901_0231643_465_812 115
105 3300042993 Ga0439440_0110609 Ga0439440_0110609_338_697 115
106 3300046675 Ga0495657_0433018 Ga0495657_0433018_192_551 115
107 3300046689 Ga0495613_0688064 Ga0495613_0688064_138_485 115
108 3300048910 Ga0496107_1074569 Ga0496107_1074569_98_445 115
109 3300048915 Ga0496112_0354627 Ga0496112_0354627_455_802 115
110 3300048917 Ga0496114_1539707 Ga0496114_1539707_194_541 115
111 3300049568 Ga0501031_0932085 Ga0501031_0932085_58_417 115
112 3300049572 Ga0501036_0739356 Ga0501036_0739356_28_387 115
113 3300049574 Ga0501038_0571799 Ga0501038_0571799_81_440 115
114 3300049576 Ga0501040_1373188 Ga0501040_1373188_89_448 115
115 3300049577 Ga0501041_0759593 Ga0501041_0759593_143_502 115
116 3300049578 Ga0501042_1285339 Ga0501042_1285339_88_447 115
117 3300049584 Ga0501068_0518043 Ga0501068_0518043_296_655 115
118 3300049588 Ga0501072_0466232 Ga0501072_0466232_538_897 115
119 3300049591 Ga0501075_0183401 Ga0501075_0183401_777_1136 115
120 3300049591 Ga0501075_1281678 Ga0501075_1281678_100_459 115
121 3300049592 Ga0501076_0575028 Ga0501076_0575028_131_490 115
122 3300049741 Ga0501079_1618844 Ga0501079_1618844_19_378 115
123 3300049742 Ga0501080_0029092 Ga0501080_0029092_820_1170 115
124 3300049742 Ga0501080_0168850 Ga0501080_0168850_1625_1984 115
125 3300049743 Ga0501081_0506447 Ga0501081_0506447_347_706 115
126 3300049824 Ga0501045_0700355 Ga0501045_0700355_44_403 115
127 3300050507 nmdc:mga05p37_566257_c1 nmdc:mga05p37_566257_c1_375_734 115
128 3300050507 nmdc:mga05p37_878808_c1 nmdc:mga05p37_878808_c1_516_875 115
129 3300050508 nmdc:mga09592_1154511_c1 nmdc:mga09592_1154511_c1_229_594 115
130 3300050508 nmdc:mga09592_160031_c1 nmdc:mga09592_160031_c1_968_1327 115
131 3300050510 nmdc:mga06r32_227529_c1 nmdc:mga06r32_227529_c1_1427_1786 115
132 3300050510 nmdc:mga06r32_300783_c1 nmdc:mga06r32_300783_c1_512_871 115
133 3300050511 nmdc:mga08y16_1076547_c1 nmdc:mga08y16_1076547_c1_35_394 115
134 3300050512 nmdc:mga0n895_1590157_c1 nmdc:mga0n895_1590157_c1_193_552 115
135 3300061734 Ga0530510_0167746 Ga0530510_0167746_180_539 115
136 3300061734 Ga0530510_0414330 Ga0530510_0414330_188_547 115
137 3300061734 Ga0530510_1470244 Ga0530510_1470244_39_398 115
138 3300000545 CNXas_1005059 CNXas_10050591 116
139 3300000549 LJQas_1000129 LJQas_10001298 116
140 3300000549 LJQas_1000175 LJQas_100017510 116
141 3300005336 Ga0070680_100346796 Ga0070680_1003467962 116
142 3300005539 Ga0068853_100629085 Ga0068853_1006290852 116
143 3300009093 Ga0105240_10030793 Ga0105240_100307932 116
144 3300013100 Ga0157373_10549241 Ga0157373_105492412 116
145 3300037471 Ga0395905_0028109 Ga0395905_0028109_4591_4941 116
146 3300037471 Ga0395905_1243972 Ga0395905_1243972_150_506 116
147 3300038443 Ga0395901_0123086 Ga0395901_0123086_546_896 116
148 3300038443 Ga0395901_1680106 Ga0395901_1680106_220_576 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02452

PemK_toxin

PemK-like, MazF-like toxin of type II toxin-antitoxin system

15

124

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hk0-assembly1.cif.gz_B crystal structure of m. tuberculosis mazf-mt3 (rv1991c) in complex with rna 0.8973 4 116
5hk0-assembly1.cif.gz_A crystal structure of m. tuberculosis mazf-mt3 (rv1991c) in complex with rna 0.8852 4 116
5xe3-assembly1.cif.gz_A endoribonuclease in complex with its cognate antitoxin from mycobacterial species 0.879 3 116
5hk3-assembly1.cif.gz_B crystal structure of m. tuberculosis mazf-mt3 t52d-f62d mutant in complex with dna 0.8776 3 116
5hk0-assembly1.cif.gz_B crystal structure of m. tuberculosis mazf-mt3 (rv1991c) in complex with rna 0.8736 4 116
ID Description Score Start End Superfamily
af_P95272_7_108_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.8879 6 115 2.30.30.110
5hk0C00 Mainly Beta;Roll;SH3 type barrels.; 0.8728 3 116 2.30.30.110
af_P9WII5_1_103_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.8671 1 116 2.30.30.110
5hk0C00 Mainly Beta;Roll;SH3 type barrels.; 0.8655 3 116 2.30.30.110
af_P95272_7_108_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.8636 6 115 2.30.30.110
ID Description Score Start End GO Terms
AF-A0A1Q7BXS4-F1-model_v4 Uncharacterized protein 0.9849 46 116
AF-A0A5A5R703-F1-model_v4 Uncharacterized protein 0.9797 46 116
AF-A0A1Q7BXS4-F1-model_v4 Uncharacterized protein 0.9714 46 116
AF-Q1PZL8-F1-model_v4 Uncharacterized protein 0.9674 46 115
AF-A0A5A5R703-F1-model_v4 Uncharacterized protein 0.9661 46 116

Feature Viewer

pLDDT pTM Quality
93.17 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map