F201189

General Info

Members Datasets Scaffolds Average Seq Length
147 117 294 385

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0304104|Ga0451576_0304104_163_1536
Length 457
Sequence MPGLPDQRVGRELQLMTVKGEPASSNLLKIDRSGPEVGGVFAETPIHIVKRTGPGRLIDIIHKDERGVIGLMSGTSVDALDIVYVRIKGRGANVRVREIVAFDSFPYAKELRDHIFELFDPNTARVDKICQMDFVLAEVWSAMIAMFLYEHNIPVNDIDIIATAGQTIWHSPDPSEFWMDGVEKPIVTGSTFAIGQSAVIAERTGILTVGDLRVRDVAAGGQGAPLVPYADWVLLRHPTLGRAIQNYGGIGNVTYLPPNCGIDRVIAFDTGPANMVIDALAKMVDPNLTCDEDGRLAAAGTVIPELLQKLLADPYFEREPPKTTGREYFGAQYARKIREEHPDASLLDLIATATALTAESIARAYRDFLVSRNHAVHEVVVGGGGPKNPTLMRMQDEAFERYIGKVVRKNHDDFGIPNQAKESVAMAIIGDEGAYGITTNVSGATGGRPTILGKISY

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
22 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
23 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
37 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
59 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
60 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
61 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
62 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
63 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
64 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
77 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
78 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
79 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
80 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
81 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
82 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
83 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
84 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
85 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
86 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
87 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
88 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
89 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
94 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
95 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
99 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
100 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
101 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
102 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
103 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
104 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
105 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
106 2671180694 Paenibacillus sp. A3 Isolate Unclassified
107 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
108 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
109 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
110 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
111 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
112 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
113 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
114 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
115 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
116 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
117 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.16
Metatranscriptomes 0
Isolates 8.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.76
Nodule 0
Rhizoplane 3.4
Rhizosphere 82.31
Stem 0
Stem Tuber 0
Unclassified 10.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0304104 3300045051 Unclassified 1668
2 JGI25151J46595_10001806 3300003187 Bacteria 13826
3 JGI25151J46595_10002614 3300003187 Bacteria 10631
4 Ga0070658_10000689 3300005327 Bacteria 29262
5 Ga0070680_100032716 3300005336 Bacteria 4186
6 Ga0070660_100023502 3300005339 Bacteria 4566
7 Ga0070669_100080218 3300005353 Bacteria 2428
8 Ga0070671_100161027 3300005355 Bacteria 1897
9 Ga0070674_100014109 3300005356 Bacteria 4960
10 Ga0070714_100006443 3300005435 Bacteria 9066
11 Ga0070714_100025014 3300005435 Bacteria 4923
12 Ga0070713_100073543 3300005436 Bacteria 2893
13 Ga0070713_100125568 3300005436 Bacteria 2256
14 Ga0070711_100162630 3300005439 Unclassified 1694
15 Ga0070707_100118463 3300005468 Bacteria 2570
16 Ga0070698_100001406 3300005471 Bacteria 26671
17 Ga0070698_100010099 3300005471 Bacteria 10083
18 Ga0070699_100027605 3300005518 Bacteria 4895
19 Ga0070697_100279358 3300005536 Bacteria 1432
20 Ga0070665_100000153 3300005548 Bacteria 126011
21 Ga0070665_100002449 3300005548 Bacteria 20462
22 Ga0068855_100001452 3300005563 Bacteria 29563
23 Ga0068855_100093693 3300005563 Bacteria 3463
24 Ga0068855_100163751 3300005563 Bacteria 2522
25 Ga0070702_100163213 3300005615 Unclassified 1442
26 Ga0070717_10127577 3300006028 Unclassified 2185
27 Ga0075431_100154614 3300006847 Bacteria 2360
28 Ga0075435_100187660 3300007076 Unclassified 1749
29 Ga0105244_10086647 3300009036 Bacteria 1544
30 Ga0105250_10000995 3300009092 Bacteria 16482
31 Ga0105250_10003687 3300009092 Bacteria 7215
32 Ga0105240_10120878 3300009093 Unclassified 3154
33 Ga0105242_10185520 3300009176 Bacteria 1838
34 Ga0105237_10000024 3300009545 Bacteria 223776
35 Ga0105238_10000226 3300009551 Bacteria 62787
36 Ga0105238_10072978 3300009551 Bacteria 3427
37 Ga0105239_10002771 3300010375 Bacteria 21975
38 Ga0157370_10004486 3300013104 Bacteria 15996
39 Ga0157369_10007276 3300013105 Bacteria 12741
40 Ga0157369_10035436 3300013105 Bacteria 5472
41 Ga0157369_10190534 3300013105 Bacteria 2155
42 Ga0157378_10000041 3300013297 Bacteria 112069
43 Ga0157378_10001468 3300013297 Bacteria 21295
44 Ga0163162_10028942 3300013306 Bacteria 5483
45 Ga0157372_10084538 3300013307 Bacteria 3597
46 Ga0157372_10084585 3300013307 Bacteria 3596
47 Ga0157372_10118162 3300013307 Bacteria 3042
48 Ga0157372_10546742 3300013307 Bacteria 1350
49 Ga0157376_10100501 3300014969 Bacteria 2526
50 Ga0209673_1002637 3300025273 Bacteria 12031
51 Ga0209025_1004173 3300025294 Bacteria 12774
52 Ga0209025_1007651 3300025294 Bacteria 7986
53 Ga0209025_1016924 3300025294 Bacteria 4251
54 Ga0209025_1040466 3300025294 Bacteria 2015
55 Ga0207696_1001048 3300025711 Bacteria 16394
56 Ga0207705_10003823 3300025909 Bacteria 11452
57 Ga0207684_10024504 3300025910 Bacteria 5143
58 Ga0207684_10169601 3300025910 Bacteria 1881
59 Ga0207695_10000407 3300025913 Bacteria 95753
60 Ga0207671_10000051 3300025914 Bacteria 189023
61 Ga0207693_10039451 3300025915 Unclassified 3719
62 Ga0207663_10153300 3300025916 Unclassified 1619
63 Ga0207657_10068170 3300025919 Bacteria 3023
64 Ga0207652_10229309 3300025921 Bacteria 1674
65 Ga0207646_10007092 3300025922 Bacteria 11465
66 Ga0207646_10011949 3300025922 Bacteria 8373
67 Ga0207694_10000033 3300025924 Bacteria 203201
68 Ga0207664_10040582 3300025929 Unclassified 3621
69 Ga0207669_10043361 3300025937 Bacteria 2634
70 Ga0207691_10089160 3300025940 Bacteria 2766
71 Ga0207640_10125576 3300025981 Bacteria 1846
72 Ga0207641_10037108 3300026088 Bacteria 4069
73 Ga0207674_10001103 3300026116 Bacteria 35082
74 Ga0268266_10000707 3300028379 Bacteria 45087
75 Ga0268266_10000750 3300028379 Bacteria 43429
76 Ga0265338_10023251 3300028800 Bacteria 6380
77 Ga0316575_10053036 3300031665 Bacteria 1615
78 Ga0307416_100083002 3300032002 Bacteria 2717
79 Ga0307415_100257474 3300032126 Bacteria 1422
80 Ga0316583_10001160 3300032133 Bacteria 8627
81 Ga0373953_0000741 3300035117 Bacteria 9038
82 Ga0373956_0006995 3300035119 Bacteria 4534
83 Ga0373957_0001865 3300035120 Bacteria 5842
84 Ga0373933_0001359 3300035724 Bacteria 14411
85 Ga0373937_0000506 3300036401 Bacteria 35587
86 Ga0373937_0007069 3300036401 Bacteria 9697
87 Ga0395900_0075446 3300037418 Bacteria 3467
88 Ga0436364_1509768 3300037853 Bacteria 1586
89 Ga0395901_0227979 3300038443 Unclassified 1946
90 Ga0451795_0541922 3300041456 Unclassified 1261
91 Ga0451577_0002347 3300042876 Bacteria 22758
92 Ga0453684_0005984 3300044712 Bacteria 23559
93 Ga0453684_0028738 3300044712 Bacteria 7919
94 Ga0453684_0103053 3300044712 Bacteria 3488
95 Ga0466959_0215228 3300045049 Unclassified 1334
96 Ga0451576_0015755 3300045051 Bacteria 8366
97 Ga0451576_0036169 3300045051 Bacteria 5236
98 Ga0466967_0126794 3300045976 Bacteria 2365
99 Ga0495592_0071044 3300046454 Bacteria 2535
100 Ga0495603_0024805 3300046455 Bacteria 3628
101 Ga0495653_0087505 3300046463 Unclassified 2288
102 Ga0495580_0149577 3300046472 Bacteria 1618
103 Ga0495608_0041841 3300046511 Bacteria 3065
104 Ga0495608_0113499 3300046511 Unclassified 1741
105 Ga0495630_0005812 3300046517 Bacteria 8718
106 Ga0495666_0062886 3300046526 Unclassified 1772
107 Ga0495587_0040812 3300046536 Bacteria 2771
108 Ga0495667_0008166 3300046559 Bacteria 7105
109 Ga0495635_0209351 3300046663 Bacteria 1321
110 Ga0495624_0001363 3300046690 Bacteria 19036
111 Ga0495600_0140713 3300046809 Bacteria 1566
112 Ga0495604_0001277 3300047317 Bacteria 20583
113 Ga0495636_0000175 3300047318 Bacteria 25993
114 Ga0495674_0032150 3300047319 Bacteria 4762
115 Ga0495684_0008138 3300047471 Bacteria 8110
116 Ga0495602_0002891 3300048088 Bacteria 17604
117 Ga0496102_0084187 3300048905 Bacteria 2935
118 Ga0496102_0273496 3300048905 Bacteria 1592
119 Ga0496103_0008957 3300048906 Bacteria 5933
120 Ga0496109_0010046 3300048912 Bacteria 8077
121 Ga0496122_0000052 3300048925 Bacteria 260977
122 Ga0496122_0006647 3300048925 Bacteria 13184
123 Ga0496122_0011494 3300048925 Bacteria 8954
124 Ga0496123_0005906 3300048926 Bacteria 12086
125 Ga0496126_0001951 3300048929 Bacteria 29288
126 Ga0501031_0088261 3300049568 Bacteria 2022
127 Ga0501038_0084309 3300049574 Bacteria 2674
128 Ga0501074_0075299 3300049590 Bacteria 2423
129 Ga0501081_0095652 3300049743 Bacteria 2094
130 Ga0501083_0113714 3300049744 Bacteria 1778
131 Ga0501045_0131703 3300049824 Bacteria 1859
132 nmdc:mga09592_30962_c1 3300050508 Bacteria 4455
133 Ga0495595_0164854 3300053084 Bacteria 1095
134 Ga0495619_0028081 3300053085 Bacteria 3628
135 2526061151 2524614857 Bacteria 4146328
136 2673821525 2671180694 Bacteria 7506943
137 2698322921 2695420987 Bacteria 6152737
138 2705995442 2703719227 Bacteria 5631989
139 2740065063 2739367875 Bacteria 4157290
140 2745169665 2744054657 Bacteria 5016802
141 2817620187 2816332336 Bacteria 5207640
142 2925334228 2925326138 Bacteria 9652120
143 2980189922 2980182181 Bacteria 9454109
144 3006970939 3006969106 Bacteria 4739423
145 3006983148 3006978542 Bacteria 5328100
146 8057475031 8057473075 Bacteria 5892720
147 8057583082 8057582654 Bacteria 5218944
148 Ga0451576_0304104
149 JGI25151J46595_10001806
150 JGI25151J46595_10002614
151 Ga0070658_10000689
152 Ga0070680_100032716
153 Ga0070660_100023502
154 Ga0070669_100080218
155 Ga0070671_100161027
156 Ga0070674_100014109
157 Ga0070714_100006443
158 Ga0070714_100025014
159 Ga0070713_100073543
160 Ga0070713_100125568
161 Ga0070711_100162630
162 Ga0070707_100118463
163 Ga0070698_100001406
164 Ga0070698_100010099
165 Ga0070699_100027605
166 Ga0070697_100279358
167 Ga0070665_100000153
168 Ga0070665_100002449
169 Ga0068855_100001452
170 Ga0068855_100093693
171 Ga0068855_100163751
172 Ga0070702_100163213
173 Ga0070717_10127577
174 Ga0075431_100154614
175 Ga0075435_100187660
176 Ga0105244_10086647
177 Ga0105250_10000995
178 Ga0105250_10003687
179 Ga0105240_10120878
180 Ga0105242_10185520
181 Ga0105237_10000024
182 Ga0105238_10000226
183 Ga0105238_10072978
184 Ga0105239_10002771
185 Ga0157370_10004486
186 Ga0157369_10007276
187 Ga0157369_10035436
188 Ga0157369_10190534
189 Ga0157378_10000041
190 Ga0157378_10001468
191 Ga0163162_10028942
192 Ga0157372_10084538
193 Ga0157372_10084585
194 Ga0157372_10118162
195 Ga0157372_10546742
196 Ga0157376_10100501
197 Ga0209673_1002637
198 Ga0209025_1004173
199 Ga0209025_1007651
200 Ga0209025_1016924
201 Ga0209025_1040466
202 Ga0207696_1001048
203 Ga0207705_10003823
204 Ga0207684_10024504
205 Ga0207684_10169601
206 Ga0207695_10000407
207 Ga0207671_10000051
208 Ga0207693_10039451
209 Ga0207663_10153300
210 Ga0207657_10068170
211 Ga0207652_10229309
212 Ga0207646_10007092
213 Ga0207646_10011949
214 Ga0207694_10000033
215 Ga0207664_10040582
216 Ga0207669_10043361
217 Ga0207691_10089160
218 Ga0207640_10125576
219 Ga0207641_10037108
220 Ga0207674_10001103
221 Ga0268266_10000707
222 Ga0268266_10000750
223 Ga0265338_10023251
224 Ga0316575_10053036
225 Ga0307416_100083002
226 Ga0307415_100257474
227 Ga0316583_10001160
228 Ga0373953_0000741
229 Ga0373956_0006995
230 Ga0373957_0001865
231 Ga0373933_0001359
232 Ga0373937_0000506
233 Ga0373937_0007069
234 Ga0395900_0075446
235 Ga0436364_1509768
236 Ga0395901_0227979
237 Ga0451795_0541922
238 Ga0451577_0002347
239 Ga0453684_0005984
240 Ga0453684_0028738
241 Ga0453684_0103053
242 Ga0466959_0215228
243 Ga0451576_0015755
244 Ga0451576_0036169
245 Ga0466967_0126794
246 Ga0495592_0071044
247 Ga0495603_0024805
248 Ga0495653_0087505
249 Ga0495580_0149577
250 Ga0495608_0041841
251 Ga0495608_0113499
252 Ga0495630_0005812
253 Ga0495666_0062886
254 Ga0495587_0040812
255 Ga0495667_0008166
256 Ga0495635_0209351
257 Ga0495624_0001363
258 Ga0495600_0140713
259 Ga0495604_0001277
260 Ga0495636_0000175
261 Ga0495674_0032150
262 Ga0495684_0008138
263 Ga0495602_0002891
264 Ga0496102_0084187
265 Ga0496102_0273496
266 Ga0496103_0008957
267 Ga0496109_0010046
268 Ga0496122_0000052
269 Ga0496122_0006647
270 Ga0496122_0011494
271 Ga0496123_0005906
272 Ga0496126_0001951
273 Ga0501031_0088261
274 Ga0501038_0084309
275 Ga0501074_0075299
276 Ga0501081_0095652
277 Ga0501083_0113714
278 Ga0501045_0131703
279 nmdc:mga09592_30962_c1
280 Ga0495595_0164854
281 Ga0495619_0028081
282 2526061151
283 2673821525
284 2698322921
285 2705995442
286 2740065063
287 2745169665
288 2817620187
289 2925334228
290 2980189922
291 3006970939
292 3006983148
293 8057475031
294 8057583082

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03702

AnmK

Anhydro-N-acetylmuramic acid kinase

66

457

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cqy-assembly1.cif.gz_A crystal structure of a functionally unknown protein (so_1313) from shewanella oneidensis mr-1 0.97 2 378
3qbx-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa 1,6-anhydro-n-actetylmuramic acid kinase (anmk) bound to 1,6-anhydro-n-actetylmuramic acid 0.9646 1 380
3qbx-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa 1,6-anhydro-n-actetylmuramic acid kinase (anmk) bound to 1,6-anhydro-n-actetylmuramic acid 0.9619 1 380
3qbw-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa 1,6-anhydro-n-actetylmuramic acid kinase (anmk) bound to adenosine diphosphate 0.955 1 376
8cpb-assembly1.cif.gz_B 1,6-anhydro-n-actetylmuramic acid kinase (anmk) in complex with amppnp, and anhmurnac at 1.7 angstroms resolution. 0.9545 1 380
ID Description Score Start End Superfamily
3cqyB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9508 149 338 3.30.420.40
3cqyB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9408 149 338 3.30.420.40
4mo4C01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9404 1 148 3.30.420.40
af_P77570_5_144_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9361 3 147 3.30.420.40
4mo4C02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9269 149 338 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A806QN05-F1-model_v4 deleted 0.9851 7 194
AF-A0A806QVK9-F1-model_v4 deleted 0.9842 202 335
AF-A0A7Y4VIU4-F1-model_v4 Anhydro-N-acetylmuramic acid kinase 0.9797 179 375 GO:0005524
GO:0006040
GO:0009254
GO:0016301
GO:0016773
AF-A0A800DR88-F1-model_v4 Anhydro-N-acetylmuramic acid kinase 0.979 2 106 GO:0005524
GO:0006040
GO:0009254
GO:0016773
AF-A0A1F6Q9K2-F1-model_v4 Anhydro-N-acetylmuramic acid kinase 0.9789 220 375 GO:0005524
GO:0006040
GO:0009254
GO:0016773

Map