F201189
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 147 | 117 | 294 | 385 |
Family's Representative Sequence
| Representative Sequence | 3300045051|Ga0451576_0304104|Ga0451576_0304104_163_1536 |
| Length | 457 |
| Sequence | MPGLPDQRVGRELQLMTVKGEPASSNLLKIDRSGPEVGGVFAETPIHIVKRTGPGRLIDIIHKDERGVIGLMSGTSVDALDIVYVRIKGRGANVRVREIVAFDSFPYAKELRDHIFELFDPNTARVDKICQMDFVLAEVWSAMIAMFLYEHNIPVNDIDIIATAGQTIWHSPDPSEFWMDGVEKPIVTGSTFAIGQSAVIAERTGILTVGDLRVRDVAAGGQGAPLVPYADWVLLRHPTLGRAIQNYGGIGNVTYLPPNCGIDRVIAFDTGPANMVIDALAKMVDPNLTCDEDGRLAAAGTVIPELLQKLLADPYFEREPPKTTGREYFGAQYARKIREEHPDASLLDLIATATALTAESIARAYRDFLVSRNHAVHEVVVGGGGPKNPTLMRMQDEAFERYIGKVVRKNHDDFGIPNQAKESVAMAIIGDEGAYGITTNVSGATGGRPTILGKISY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 18 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 21 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 22 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 36 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 37 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 56 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 57 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 58 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 59 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 60 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 61 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 62 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 63 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 64 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 65 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 66 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 67 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 68 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 69 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 70 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 71 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 72 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 73 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 91 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 92 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 93 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 94 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 95 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 96 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 97 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 98 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 99 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 100 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 101 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 102 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 103 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 105 | 2524614857 | Deinococcus ficus DSM 19119 | Isolate | Rhizosphere |
| 106 | 2671180694 | Paenibacillus sp. A3 | Isolate | Unclassified |
| 107 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 108 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 109 | 2739367875 | Deinococcus ficus CC-FR2-10 | Isolate | Unclassified |
| 110 | 2744054657 | Brevibacillus sp. SKDU10 | Isolate | Unclassified |
| 111 | 2816332336 | Brevibacillus laterosporus ZQ2 | Isolate | Unclassified |
| 112 | 2925326138 | Paenibacillus hemerocallicola KCTC 33185 | Isolate | Unclassified |
| 113 | 2980182181 | Paenibacillus cymbidii R196 | Isolate | Unclassified |
| 114 | 3006969106 | Bacillus sp. FJAT-50079 | Isolate | Rhizosphere |
| 115 | 3006978542 | Bacillus sp. FJAT-49705 | Isolate | Rhizosphere |
| 116 | 8057473075 | Paenibacillus endoradicis T3-5-0-4 | Isolate | Unclassified |
| 117 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.16 |
| Metatranscriptomes | 0 |
| Isolates | 8.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.76 |
| Nodule | 0 |
| Rhizoplane | 3.4 |
| Rhizosphere | 82.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451576_0304104 | 3300045051 | Unclassified | 1668 |
| 2 | JGI25151J46595_10001806 | 3300003187 | Bacteria | 13826 |
| 3 | JGI25151J46595_10002614 | 3300003187 | Bacteria | 10631 |
| 4 | Ga0070658_10000689 | 3300005327 | Bacteria | 29262 |
| 5 | Ga0070680_100032716 | 3300005336 | Bacteria | 4186 |
| 6 | Ga0070660_100023502 | 3300005339 | Bacteria | 4566 |
| 7 | Ga0070669_100080218 | 3300005353 | Bacteria | 2428 |
| 8 | Ga0070671_100161027 | 3300005355 | Bacteria | 1897 |
| 9 | Ga0070674_100014109 | 3300005356 | Bacteria | 4960 |
| 10 | Ga0070714_100006443 | 3300005435 | Bacteria | 9066 |
| 11 | Ga0070714_100025014 | 3300005435 | Bacteria | 4923 |
| 12 | Ga0070713_100073543 | 3300005436 | Bacteria | 2893 |
| 13 | Ga0070713_100125568 | 3300005436 | Bacteria | 2256 |
| 14 | Ga0070711_100162630 | 3300005439 | Unclassified | 1694 |
| 15 | Ga0070707_100118463 | 3300005468 | Bacteria | 2570 |
| 16 | Ga0070698_100001406 | 3300005471 | Bacteria | 26671 |
| 17 | Ga0070698_100010099 | 3300005471 | Bacteria | 10083 |
| 18 | Ga0070699_100027605 | 3300005518 | Bacteria | 4895 |
| 19 | Ga0070697_100279358 | 3300005536 | Bacteria | 1432 |
| 20 | Ga0070665_100000153 | 3300005548 | Bacteria | 126011 |
| 21 | Ga0070665_100002449 | 3300005548 | Bacteria | 20462 |
| 22 | Ga0068855_100001452 | 3300005563 | Bacteria | 29563 |
| 23 | Ga0068855_100093693 | 3300005563 | Bacteria | 3463 |
| 24 | Ga0068855_100163751 | 3300005563 | Bacteria | 2522 |
| 25 | Ga0070702_100163213 | 3300005615 | Unclassified | 1442 |
| 26 | Ga0070717_10127577 | 3300006028 | Unclassified | 2185 |
| 27 | Ga0075431_100154614 | 3300006847 | Bacteria | 2360 |
| 28 | Ga0075435_100187660 | 3300007076 | Unclassified | 1749 |
| 29 | Ga0105244_10086647 | 3300009036 | Bacteria | 1544 |
| 30 | Ga0105250_10000995 | 3300009092 | Bacteria | 16482 |
| 31 | Ga0105250_10003687 | 3300009092 | Bacteria | 7215 |
| 32 | Ga0105240_10120878 | 3300009093 | Unclassified | 3154 |
| 33 | Ga0105242_10185520 | 3300009176 | Bacteria | 1838 |
| 34 | Ga0105237_10000024 | 3300009545 | Bacteria | 223776 |
| 35 | Ga0105238_10000226 | 3300009551 | Bacteria | 62787 |
| 36 | Ga0105238_10072978 | 3300009551 | Bacteria | 3427 |
| 37 | Ga0105239_10002771 | 3300010375 | Bacteria | 21975 |
| 38 | Ga0157370_10004486 | 3300013104 | Bacteria | 15996 |
| 39 | Ga0157369_10007276 | 3300013105 | Bacteria | 12741 |
| 40 | Ga0157369_10035436 | 3300013105 | Bacteria | 5472 |
| 41 | Ga0157369_10190534 | 3300013105 | Bacteria | 2155 |
| 42 | Ga0157378_10000041 | 3300013297 | Bacteria | 112069 |
| 43 | Ga0157378_10001468 | 3300013297 | Bacteria | 21295 |
| 44 | Ga0163162_10028942 | 3300013306 | Bacteria | 5483 |
| 45 | Ga0157372_10084538 | 3300013307 | Bacteria | 3597 |
| 46 | Ga0157372_10084585 | 3300013307 | Bacteria | 3596 |
| 47 | Ga0157372_10118162 | 3300013307 | Bacteria | 3042 |
| 48 | Ga0157372_10546742 | 3300013307 | Bacteria | 1350 |
| 49 | Ga0157376_10100501 | 3300014969 | Bacteria | 2526 |
| 50 | Ga0209673_1002637 | 3300025273 | Bacteria | 12031 |
| 51 | Ga0209025_1004173 | 3300025294 | Bacteria | 12774 |
| 52 | Ga0209025_1007651 | 3300025294 | Bacteria | 7986 |
| 53 | Ga0209025_1016924 | 3300025294 | Bacteria | 4251 |
| 54 | Ga0209025_1040466 | 3300025294 | Bacteria | 2015 |
| 55 | Ga0207696_1001048 | 3300025711 | Bacteria | 16394 |
| 56 | Ga0207705_10003823 | 3300025909 | Bacteria | 11452 |
| 57 | Ga0207684_10024504 | 3300025910 | Bacteria | 5143 |
| 58 | Ga0207684_10169601 | 3300025910 | Bacteria | 1881 |
| 59 | Ga0207695_10000407 | 3300025913 | Bacteria | 95753 |
| 60 | Ga0207671_10000051 | 3300025914 | Bacteria | 189023 |
| 61 | Ga0207693_10039451 | 3300025915 | Unclassified | 3719 |
| 62 | Ga0207663_10153300 | 3300025916 | Unclassified | 1619 |
| 63 | Ga0207657_10068170 | 3300025919 | Bacteria | 3023 |
| 64 | Ga0207652_10229309 | 3300025921 | Bacteria | 1674 |
| 65 | Ga0207646_10007092 | 3300025922 | Bacteria | 11465 |
| 66 | Ga0207646_10011949 | 3300025922 | Bacteria | 8373 |
| 67 | Ga0207694_10000033 | 3300025924 | Bacteria | 203201 |
| 68 | Ga0207664_10040582 | 3300025929 | Unclassified | 3621 |
| 69 | Ga0207669_10043361 | 3300025937 | Bacteria | 2634 |
| 70 | Ga0207691_10089160 | 3300025940 | Bacteria | 2766 |
| 71 | Ga0207640_10125576 | 3300025981 | Bacteria | 1846 |
| 72 | Ga0207641_10037108 | 3300026088 | Bacteria | 4069 |
| 73 | Ga0207674_10001103 | 3300026116 | Bacteria | 35082 |
| 74 | Ga0268266_10000707 | 3300028379 | Bacteria | 45087 |
| 75 | Ga0268266_10000750 | 3300028379 | Bacteria | 43429 |
| 76 | Ga0265338_10023251 | 3300028800 | Bacteria | 6380 |
| 77 | Ga0316575_10053036 | 3300031665 | Bacteria | 1615 |
| 78 | Ga0307416_100083002 | 3300032002 | Bacteria | 2717 |
| 79 | Ga0307415_100257474 | 3300032126 | Bacteria | 1422 |
| 80 | Ga0316583_10001160 | 3300032133 | Bacteria | 8627 |
| 81 | Ga0373953_0000741 | 3300035117 | Bacteria | 9038 |
| 82 | Ga0373956_0006995 | 3300035119 | Bacteria | 4534 |
| 83 | Ga0373957_0001865 | 3300035120 | Bacteria | 5842 |
| 84 | Ga0373933_0001359 | 3300035724 | Bacteria | 14411 |
| 85 | Ga0373937_0000506 | 3300036401 | Bacteria | 35587 |
| 86 | Ga0373937_0007069 | 3300036401 | Bacteria | 9697 |
| 87 | Ga0395900_0075446 | 3300037418 | Bacteria | 3467 |
| 88 | Ga0436364_1509768 | 3300037853 | Bacteria | 1586 |
| 89 | Ga0395901_0227979 | 3300038443 | Unclassified | 1946 |
| 90 | Ga0451795_0541922 | 3300041456 | Unclassified | 1261 |
| 91 | Ga0451577_0002347 | 3300042876 | Bacteria | 22758 |
| 92 | Ga0453684_0005984 | 3300044712 | Bacteria | 23559 |
| 93 | Ga0453684_0028738 | 3300044712 | Bacteria | 7919 |
| 94 | Ga0453684_0103053 | 3300044712 | Bacteria | 3488 |
| 95 | Ga0466959_0215228 | 3300045049 | Unclassified | 1334 |
| 96 | Ga0451576_0015755 | 3300045051 | Bacteria | 8366 |
| 97 | Ga0451576_0036169 | 3300045051 | Bacteria | 5236 |
| 98 | Ga0466967_0126794 | 3300045976 | Bacteria | 2365 |
| 99 | Ga0495592_0071044 | 3300046454 | Bacteria | 2535 |
| 100 | Ga0495603_0024805 | 3300046455 | Bacteria | 3628 |
| 101 | Ga0495653_0087505 | 3300046463 | Unclassified | 2288 |
| 102 | Ga0495580_0149577 | 3300046472 | Bacteria | 1618 |
| 103 | Ga0495608_0041841 | 3300046511 | Bacteria | 3065 |
| 104 | Ga0495608_0113499 | 3300046511 | Unclassified | 1741 |
| 105 | Ga0495630_0005812 | 3300046517 | Bacteria | 8718 |
| 106 | Ga0495666_0062886 | 3300046526 | Unclassified | 1772 |
| 107 | Ga0495587_0040812 | 3300046536 | Bacteria | 2771 |
| 108 | Ga0495667_0008166 | 3300046559 | Bacteria | 7105 |
| 109 | Ga0495635_0209351 | 3300046663 | Bacteria | 1321 |
| 110 | Ga0495624_0001363 | 3300046690 | Bacteria | 19036 |
| 111 | Ga0495600_0140713 | 3300046809 | Bacteria | 1566 |
| 112 | Ga0495604_0001277 | 3300047317 | Bacteria | 20583 |
| 113 | Ga0495636_0000175 | 3300047318 | Bacteria | 25993 |
| 114 | Ga0495674_0032150 | 3300047319 | Bacteria | 4762 |
| 115 | Ga0495684_0008138 | 3300047471 | Bacteria | 8110 |
| 116 | Ga0495602_0002891 | 3300048088 | Bacteria | 17604 |
| 117 | Ga0496102_0084187 | 3300048905 | Bacteria | 2935 |
| 118 | Ga0496102_0273496 | 3300048905 | Bacteria | 1592 |
| 119 | Ga0496103_0008957 | 3300048906 | Bacteria | 5933 |
| 120 | Ga0496109_0010046 | 3300048912 | Bacteria | 8077 |
| 121 | Ga0496122_0000052 | 3300048925 | Bacteria | 260977 |
| 122 | Ga0496122_0006647 | 3300048925 | Bacteria | 13184 |
| 123 | Ga0496122_0011494 | 3300048925 | Bacteria | 8954 |
| 124 | Ga0496123_0005906 | 3300048926 | Bacteria | 12086 |
| 125 | Ga0496126_0001951 | 3300048929 | Bacteria | 29288 |
| 126 | Ga0501031_0088261 | 3300049568 | Bacteria | 2022 |
| 127 | Ga0501038_0084309 | 3300049574 | Bacteria | 2674 |
| 128 | Ga0501074_0075299 | 3300049590 | Bacteria | 2423 |
| 129 | Ga0501081_0095652 | 3300049743 | Bacteria | 2094 |
| 130 | Ga0501083_0113714 | 3300049744 | Bacteria | 1778 |
| 131 | Ga0501045_0131703 | 3300049824 | Bacteria | 1859 |
| 132 | nmdc:mga09592_30962_c1 | 3300050508 | Bacteria | 4455 |
| 133 | Ga0495595_0164854 | 3300053084 | Bacteria | 1095 |
| 134 | Ga0495619_0028081 | 3300053085 | Bacteria | 3628 |
| 135 | 2526061151 | 2524614857 | Bacteria | 4146328 |
| 136 | 2673821525 | 2671180694 | Bacteria | 7506943 |
| 137 | 2698322921 | 2695420987 | Bacteria | 6152737 |
| 138 | 2705995442 | 2703719227 | Bacteria | 5631989 |
| 139 | 2740065063 | 2739367875 | Bacteria | 4157290 |
| 140 | 2745169665 | 2744054657 | Bacteria | 5016802 |
| 141 | 2817620187 | 2816332336 | Bacteria | 5207640 |
| 142 | 2925334228 | 2925326138 | Bacteria | 9652120 |
| 143 | 2980189922 | 2980182181 | Bacteria | 9454109 |
| 144 | 3006970939 | 3006969106 | Bacteria | 4739423 |
| 145 | 3006983148 | 3006978542 | Bacteria | 5328100 |
| 146 | 8057475031 | 8057473075 | Bacteria | 5892720 |
| 147 | 8057583082 | 8057582654 | Bacteria | 5218944 |
| 148 | Ga0451576_0304104 | |||
| 149 | JGI25151J46595_10001806 | |||
| 150 | JGI25151J46595_10002614 | |||
| 151 | Ga0070658_10000689 | |||
| 152 | Ga0070680_100032716 | |||
| 153 | Ga0070660_100023502 | |||
| 154 | Ga0070669_100080218 | |||
| 155 | Ga0070671_100161027 | |||
| 156 | Ga0070674_100014109 | |||
| 157 | Ga0070714_100006443 | |||
| 158 | Ga0070714_100025014 | |||
| 159 | Ga0070713_100073543 | |||
| 160 | Ga0070713_100125568 | |||
| 161 | Ga0070711_100162630 | |||
| 162 | Ga0070707_100118463 | |||
| 163 | Ga0070698_100001406 | |||
| 164 | Ga0070698_100010099 | |||
| 165 | Ga0070699_100027605 | |||
| 166 | Ga0070697_100279358 | |||
| 167 | Ga0070665_100000153 | |||
| 168 | Ga0070665_100002449 | |||
| 169 | Ga0068855_100001452 | |||
| 170 | Ga0068855_100093693 | |||
| 171 | Ga0068855_100163751 | |||
| 172 | Ga0070702_100163213 | |||
| 173 | Ga0070717_10127577 | |||
| 174 | Ga0075431_100154614 | |||
| 175 | Ga0075435_100187660 | |||
| 176 | Ga0105244_10086647 | |||
| 177 | Ga0105250_10000995 | |||
| 178 | Ga0105250_10003687 | |||
| 179 | Ga0105240_10120878 | |||
| 180 | Ga0105242_10185520 | |||
| 181 | Ga0105237_10000024 | |||
| 182 | Ga0105238_10000226 | |||
| 183 | Ga0105238_10072978 | |||
| 184 | Ga0105239_10002771 | |||
| 185 | Ga0157370_10004486 | |||
| 186 | Ga0157369_10007276 | |||
| 187 | Ga0157369_10035436 | |||
| 188 | Ga0157369_10190534 | |||
| 189 | Ga0157378_10000041 | |||
| 190 | Ga0157378_10001468 | |||
| 191 | Ga0163162_10028942 | |||
| 192 | Ga0157372_10084538 | |||
| 193 | Ga0157372_10084585 | |||
| 194 | Ga0157372_10118162 | |||
| 195 | Ga0157372_10546742 | |||
| 196 | Ga0157376_10100501 | |||
| 197 | Ga0209673_1002637 | |||
| 198 | Ga0209025_1004173 | |||
| 199 | Ga0209025_1007651 | |||
| 200 | Ga0209025_1016924 | |||
| 201 | Ga0209025_1040466 | |||
| 202 | Ga0207696_1001048 | |||
| 203 | Ga0207705_10003823 | |||
| 204 | Ga0207684_10024504 | |||
| 205 | Ga0207684_10169601 | |||
| 206 | Ga0207695_10000407 | |||
| 207 | Ga0207671_10000051 | |||
| 208 | Ga0207693_10039451 | |||
| 209 | Ga0207663_10153300 | |||
| 210 | Ga0207657_10068170 | |||
| 211 | Ga0207652_10229309 | |||
| 212 | Ga0207646_10007092 | |||
| 213 | Ga0207646_10011949 | |||
| 214 | Ga0207694_10000033 | |||
| 215 | Ga0207664_10040582 | |||
| 216 | Ga0207669_10043361 | |||
| 217 | Ga0207691_10089160 | |||
| 218 | Ga0207640_10125576 | |||
| 219 | Ga0207641_10037108 | |||
| 220 | Ga0207674_10001103 | |||
| 221 | Ga0268266_10000707 | |||
| 222 | Ga0268266_10000750 | |||
| 223 | Ga0265338_10023251 | |||
| 224 | Ga0316575_10053036 | |||
| 225 | Ga0307416_100083002 | |||
| 226 | Ga0307415_100257474 | |||
| 227 | Ga0316583_10001160 | |||
| 228 | Ga0373953_0000741 | |||
| 229 | Ga0373956_0006995 | |||
| 230 | Ga0373957_0001865 | |||
| 231 | Ga0373933_0001359 | |||
| 232 | Ga0373937_0000506 | |||
| 233 | Ga0373937_0007069 | |||
| 234 | Ga0395900_0075446 | |||
| 235 | Ga0436364_1509768 | |||
| 236 | Ga0395901_0227979 | |||
| 237 | Ga0451795_0541922 | |||
| 238 | Ga0451577_0002347 | |||
| 239 | Ga0453684_0005984 | |||
| 240 | Ga0453684_0028738 | |||
| 241 | Ga0453684_0103053 | |||
| 242 | Ga0466959_0215228 | |||
| 243 | Ga0451576_0015755 | |||
| 244 | Ga0451576_0036169 | |||
| 245 | Ga0466967_0126794 | |||
| 246 | Ga0495592_0071044 | |||
| 247 | Ga0495603_0024805 | |||
| 248 | Ga0495653_0087505 | |||
| 249 | Ga0495580_0149577 | |||
| 250 | Ga0495608_0041841 | |||
| 251 | Ga0495608_0113499 | |||
| 252 | Ga0495630_0005812 | |||
| 253 | Ga0495666_0062886 | |||
| 254 | Ga0495587_0040812 | |||
| 255 | Ga0495667_0008166 | |||
| 256 | Ga0495635_0209351 | |||
| 257 | Ga0495624_0001363 | |||
| 258 | Ga0495600_0140713 | |||
| 259 | Ga0495604_0001277 | |||
| 260 | Ga0495636_0000175 | |||
| 261 | Ga0495674_0032150 | |||
| 262 | Ga0495684_0008138 | |||
| 263 | Ga0495602_0002891 | |||
| 264 | Ga0496102_0084187 | |||
| 265 | Ga0496102_0273496 | |||
| 266 | Ga0496103_0008957 | |||
| 267 | Ga0496109_0010046 | |||
| 268 | Ga0496122_0000052 | |||
| 269 | Ga0496122_0006647 | |||
| 270 | Ga0496122_0011494 | |||
| 271 | Ga0496123_0005906 | |||
| 272 | Ga0496126_0001951 | |||
| 273 | Ga0501031_0088261 | |||
| 274 | Ga0501038_0084309 | |||
| 275 | Ga0501074_0075299 | |||
| 276 | Ga0501081_0095652 | |||
| 277 | Ga0501083_0113714 | |||
| 278 | Ga0501045_0131703 | |||
| 279 | nmdc:mga09592_30962_c1 | |||
| 280 | Ga0495595_0164854 | |||
| 281 | Ga0495619_0028081 | |||
| 282 | 2526061151 | |||
| 283 | 2673821525 | |||
| 284 | 2698322921 | |||
| 285 | 2705995442 | |||
| 286 | 2740065063 | |||
| 287 | 2745169665 | |||
| 288 | 2817620187 | |||
| 289 | 2925334228 | |||
| 290 | 2980189922 | |||
| 291 | 3006970939 | |||
| 292 | 3006983148 | |||
| 293 | 8057475031 | |||
| 294 | 8057583082 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cqy-assembly1.cif.gz_A | crystal structure of a functionally unknown protein (so_1313) from shewanella oneidensis mr-1 | 0.97 | 2 | 378 |
| 3qbx-assembly1.cif.gz_A | crystal structure of pseudomonas aeruginosa 1,6-anhydro-n-actetylmuramic acid kinase (anmk) bound to 1,6-anhydro-n-actetylmuramic acid | 0.9646 | 1 | 380 |
| 3qbx-assembly1.cif.gz_A | crystal structure of pseudomonas aeruginosa 1,6-anhydro-n-actetylmuramic acid kinase (anmk) bound to 1,6-anhydro-n-actetylmuramic acid | 0.9619 | 1 | 380 |
| 3qbw-assembly1.cif.gz_A | crystal structure of pseudomonas aeruginosa 1,6-anhydro-n-actetylmuramic acid kinase (anmk) bound to adenosine diphosphate | 0.955 | 1 | 376 |
| 8cpb-assembly1.cif.gz_B | 1,6-anhydro-n-actetylmuramic acid kinase (anmk) in complex with amppnp, and anhmurnac at 1.7 angstroms resolution. | 0.9545 | 1 | 380 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3cqyB02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9508 | 149 | 338 | 3.30.420.40 |
| 3cqyB02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9408 | 149 | 338 | 3.30.420.40 |
| 4mo4C01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9404 | 1 | 148 | 3.30.420.40 |
| af_P77570_5_144_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9361 | 3 | 147 | 3.30.420.40 |
| 4mo4C02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9269 | 149 | 338 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A806QN05-F1-model_v4 | deleted | 0.9851 | 7 | 194 |
|
| AF-A0A806QVK9-F1-model_v4 | deleted | 0.9842 | 202 | 335 |
|
| AF-A0A7Y4VIU4-F1-model_v4 | Anhydro-N-acetylmuramic acid kinase | 0.9797 | 179 | 375 |
GO:0005524
GO:0006040 GO:0009254 GO:0016301 GO:0016773 |
| AF-A0A800DR88-F1-model_v4 | Anhydro-N-acetylmuramic acid kinase | 0.979 | 2 | 106 |
GO:0005524
GO:0006040 GO:0009254 GO:0016773 |
| AF-A0A1F6Q9K2-F1-model_v4 | Anhydro-N-acetylmuramic acid kinase | 0.9789 | 220 | 375 |
GO:0005524
GO:0006040 GO:0009254 GO:0016773 |