F201160

General Info

Members Datasets Scaffolds Average Seq Length
147 101 294 289

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0001461|Ga0453684_0001461_15821_16867
Length 348
Sequence MKGIILAGGTGTRLHPITLAISKQLMPIYDKPMIYYPLSVLMGAGIRDILIITTLEDQRAFFNLLGDGSLYGCNFSYVAQAQPNGLAQAFVLGERFIGQDKVCLILGDNIFYGNHVEDLARASTDPDGGIIFAYHVADPGRYGVVEFDSEKRAISIEEKPAQPKSSFAVPGIYFYDNKVVSIAKNLQPSARGEYEITDVNAEYLRQGRLKVQILEQGVAWLDTGTFDSMMQASNFVEVVENRQEIKIGCIEEIAYKMGYINADQLRLLADRTLKSGYGNYLLNLLKREQILGSVISDRRKAGIYPGENQESAGISLKNQANPRTSTAPNVQIKEEIFTLDLRRNNLSD

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
66 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
71 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
75 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
76 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
81 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
84 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
85 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
86 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
87 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
88 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
89 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
90 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
91 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
92 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
93 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
94 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
95 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
96 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
97 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
98 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
99 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
100 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
101 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.96
Metatranscriptomes 0
Isolates 2.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 0
Rhizosphere 94.56
Stem 0
Stem Tuber 0
Unclassified 2.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0001461 3300044712 Bacteria 66929
2 SwRhRL2b_contig_3726896 2162886007 Bacteria 6591
3 rootH2_10103180 3300003320 Bacteria 1831
4 Ga0065707_10000519 3300005295 Bacteria 44472
5 Ga0065707_10030638 3300005295 Unclassified 1395
6 Ga0065707_10091407 3300005295 Bacteria 3952
7 Ga0065707_10094427 3300005295 Bacteria 3500
8 Ga0065707_10104560 3300005295 Bacteria 2689
9 Ga0070658_10001125 3300005327 Bacteria 22830
10 Ga0070689_100098262 3300005340 Bacteria 2315
11 Ga0070691_10041357 3300005341 Bacteria 2179
12 Ga0070709_10010532 3300005434 Bacteria 5124
13 Ga0070700_100029028 3300005441 Bacteria 3295
14 Ga0070694_100194035 3300005444 Bacteria 1510
15 Ga0070678_100189649 3300005456 Bacteria 1689
16 Ga0070706_100012087 3300005467 Bacteria 8012
17 Ga0070706_100458023 3300005467 Bacteria 1187
18 Ga0070707_100208185 3300005468 Bacteria 1906
19 Ga0070698_100002225 3300005471 Bacteria 21473
20 Ga0070698_100044032 3300005471 Bacteria 4573
21 Ga0070698_100291651 3300005471 Bacteria 1562
22 Ga0070699_100019629 3300005518 Bacteria 5823
23 Ga0070699_100101138 3300005518 Bacteria 2526
24 Ga0070697_100024680 3300005536 Bacteria 4788
25 Ga0070697_100115410 3300005536 Bacteria 2242
26 Ga0068853_100251118 3300005539 Bacteria 1623
27 Ga0070695_100040237 3300005545 Bacteria 2958
28 Ga0070696_100125249 3300005546 Bacteria 1864
29 Ga0070704_100234619 3300005549 Bacteria 1498
30 Ga0068852_100135313 3300005616 Bacteria 2275
31 Ga0068852_100337858 3300005616 Bacteria 1467
32 Ga0068859_100107203 3300005617 Bacteria 2854
33 Ga0068864_100053067 3300005618 Bacteria 3496
34 Ga0068860_100182557 3300005843 Bacteria 2028
35 Ga0068860_100422326 3300005843 Bacteria 1322
36 Ga0068862_100023551 3300005844 Bacteria 5160
37 Ga0081539_10075538 3300005985 Bacteria 1789
38 Ga0070716_100004955 3300006173 Bacteria 6410
39 Ga0075427_10000849 3300006194 Bacteria 3751
40 Ga0097621_100149922 3300006237 Bacteria 1999
41 Ga0068871_100051664 3300006358 Bacteria 3328
42 Ga0075428_100588329 3300006844 Bacteria 1189
43 Ga0075433_10009404 3300006852 Bacteria 7810
44 Ga0075429_100388635 3300006880 Bacteria 1222
45 Ga0097620_100107199 3300006931 Bacteria 2854
46 Ga0111539_10015926 3300009094 Bacteria 9340
47 Ga0111539_10023374 3300009094 Bacteria 7593
48 Ga0114129_10000389 3300009147 Bacteria 51194
49 Ga0114129_10005147 3300009147 Bacteria 18406
50 Ga0114129_10085573 3300009147 Bacteria 4374
51 Ga0114129_10306917 3300009147 Bacteria 2113
52 Ga0114129_10396399 3300009147 Bacteria 1820
53 Ga0114129_10458270 3300009147 Bacteria 1671
54 Ga0105243_10006029 3300009148 Bacteria 9381
55 Ga0105243_10128953 3300009148 Bacteria 2143
56 Ga0105237_10075449 3300009545 Bacteria 3363
57 Ga0105239_10001005 3300010375 Bacteria 39514
58 Ga0105246_10100621 3300011119 Bacteria 2103
59 Ga0157370_10196681 3300013104 Bacteria 1871
60 Ga0157370_10577637 3300013104 Bacteria 1030
61 Ga0157374_10714814 3300013296 Bacteria 1015
62 Ga0157378_10092925 3300013297 Bacteria 2745
63 Ga0163162_10090114 3300013306 Bacteria 3148
64 Ga0157372_10580144 3300013307 Bacteria 1307
65 Ga0157375_10108204 3300013308 Bacteria 2874
66 Ga0157375_10920269 3300013308 Bacteria 1018
67 Ga0157380_10141269 3300014326 Bacteria 2069
68 Ga0157380_10344936 3300014326 Bacteria 1391
69 Ga0213876_10185001 3300021384 Bacteria 1108
70 Ga0207705_10010192 3300025909 Bacteria 6837
71 Ga0207705_10066710 3300025909 Bacteria 2603
72 Ga0207684_10197077 3300025910 Bacteria 1737
73 Ga0207671_10120408 3300025914 Bacteria 2006
74 Ga0207646_10103554 3300025922 Bacteria 2553
75 Ga0207644_10036239 3300025931 Bacteria 3462
76 Ga0207709_10055345 3300025935 Bacteria 2450
77 Ga0207665_10020202 3300025939 Bacteria 4376
78 Ga0207691_10172267 3300025940 Bacteria 1895
79 Ga0207658_10407750 3300025986 Bacteria 1196
80 Ga0207708_10284597 3300026075 Unclassified 1340
81 Ga0207641_10154707 3300026088 Bacteria 2080
82 Ga0207676_10101777 3300026095 Bacteria 2383
83 Ga0207676_10200027 3300026095 Bacteria 1765
84 Ga0207674_10223060 3300026116 Bacteria 1833
85 Ga0207674_10628653 3300026116 Bacteria 1037
86 Ga0207683_10227185 3300026121 Bacteria 1702
87 Ga0207698_10217047 3300026142 Bacteria 1725
88 Ga0207698_10633941 3300026142 Bacteria 1057
89 Ga0268265_10134243 3300028380 Unclassified 2062
90 Ga0265327_10000054 3300031251 Bacteria 250337
91 Ga0316578_10120165 3300031728 Bacteria 1579
92 Ga0307415_100369241 3300032126 Bacteria 1214
93 Ga0316574_0013031 3300035398 Bacteria 4770
94 Ga0373937_0203786 3300036401 Bacteria 1860
95 Ga0316582_0036600 3300036647 Bacteria 3038
96 Ga0316584_0005540 3300036712 Bacteria 8486
97 Ga0436365_1437359 3300039437 Bacteria 3831
98 Ga0451577_0045757 3300042876 Bacteria 3917
99 Ga0451577_0285331 3300042876 Bacteria 1496
100 Ga0466972_0000026 3300044658 Bacteria 184739
101 Ga0453683_0212727 3300044673 Bacteria 1228
102 Ga0466963_0118806 3300044694 Bacteria 1818
103 Ga0453684_0017222 3300044712 Bacteria 11217
104 Ga0453684_0066518 3300044712 Bacteria 4589
105 Ga0453684_0119373 3300044712 Bacteria 3187
106 Ga0453684_0139421 3300044712 Bacteria 2898
107 Ga0453684_0415086 3300044712 Bacteria 1505
108 Ga0466957_0073027 3300044842 Bacteria 2125
109 Ga0451576_0011863 3300045051 Bacteria 9861
110 Ga0451576_0013190 3300045051 Bacteria 9247
111 Ga0451576_0165894 3300045051 Bacteria 2305
112 Ga0451576_0184002 3300045051 Bacteria 2181
113 Ga0451576_0189228 3300045051 Bacteria 2149
114 Ga0451576_1185735 3300045051 Unclassified 798
115 Ga0466958_0107394 3300045836 Bacteria 1741
116 Ga0496124_0113785 3300048927 Bacteria 2174
117 Ga0501032_0126946 3300049569 Bacteria 1685
118 Ga0501039_0206723 3300049575 Bacteria 1543
119 Ga0501039_0255120 3300049575 Bacteria 1379
120 Ga0501071_0049750 3300049587 Bacteria 3018
121 Ga0501075_0025274 3300049591 Bacteria 4364
122 Ga0501076_0069181 3300049592 Bacteria 2821
123 Ga0501076_0079000 3300049592 Bacteria 2641
124 Ga0501079_0296935 3300049741 Bacteria 1264
125 Ga0501080_0049417 3300049742 Bacteria 3915
126 Ga0501081_0087217 3300049743 Bacteria 2192
127 Ga0501081_0283993 3300049743 Bacteria 1212
128 Ga0501044_0045535 3300049823 Bacteria 4545
129 nmdc:mga05p37_1129_c1 3300050507 Bacteria 30665
130 nmdc:mga05p37_12000_c1 3300050507 Bacteria 10340
131 nmdc:mga05p37_341848_c1 3300050507 Bacteria 1765
132 nmdc:mga05p37_439398_c1 3300050507 Bacteria 1513
133 nmdc:mga09592_346973_c1 3300050508 Bacteria 1285
134 nmdc:mga09592_44813_c1 3300050508 Bacteria 3725
135 nmdc:mga0qj67_170290_c1 3300050509 Bacteria 1768
136 nmdc:mga06r32_52634_c1 3300050510 Bacteria 3899
137 nmdc:mga06r32_92838_c1 3300050510 Bacteria 2951
138 nmdc:mga08x19_212005_c1 3300050514 Bacteria 1330
139 Ga0500556_0118065 3300053104 Bacteria 1033
140 Ga0501084_0012118 3300054114 Bacteria 7137
141 Ga0501084_0053288 3300054114 Bacteria 3384
142 Ga0501084_0305353 3300054114 Bacteria 1344
143 Ga0501082_0338111 3300060353 Bacteria 1312
144 Ga0530510_0153037 3300061734 Bacteria 1704
145 2644643874 2643221716 Bacteria 4986332
146 2645722456 2643221961 Bacteria 3919167
147 2645725427 2643221962 Bacteria 3874254
148 Ga0453684_0001461
149 SwRhRL2b_contig_3726896
150 rootH2_10103180
151 Ga0065707_10000519
152 Ga0065707_10030638
153 Ga0065707_10091407
154 Ga0065707_10094427
155 Ga0065707_10104560
156 Ga0070658_10001125
157 Ga0070689_100098262
158 Ga0070691_10041357
159 Ga0070709_10010532
160 Ga0070700_100029028
161 Ga0070694_100194035
162 Ga0070678_100189649
163 Ga0070706_100012087
164 Ga0070706_100458023
165 Ga0070707_100208185
166 Ga0070698_100002225
167 Ga0070698_100044032
168 Ga0070698_100291651
169 Ga0070699_100019629
170 Ga0070699_100101138
171 Ga0070697_100024680
172 Ga0070697_100115410
173 Ga0068853_100251118
174 Ga0070695_100040237
175 Ga0070696_100125249
176 Ga0070704_100234619
177 Ga0068852_100135313
178 Ga0068852_100337858
179 Ga0068859_100107203
180 Ga0068864_100053067
181 Ga0068860_100182557
182 Ga0068860_100422326
183 Ga0068862_100023551
184 Ga0081539_10075538
185 Ga0070716_100004955
186 Ga0075427_10000849
187 Ga0097621_100149922
188 Ga0068871_100051664
189 Ga0075428_100588329
190 Ga0075433_10009404
191 Ga0075429_100388635
192 Ga0097620_100107199
193 Ga0111539_10015926
194 Ga0111539_10023374
195 Ga0114129_10000389
196 Ga0114129_10005147
197 Ga0114129_10085573
198 Ga0114129_10306917
199 Ga0114129_10396399
200 Ga0114129_10458270
201 Ga0105243_10006029
202 Ga0105243_10128953
203 Ga0105237_10075449
204 Ga0105239_10001005
205 Ga0105246_10100621
206 Ga0157370_10196681
207 Ga0157370_10577637
208 Ga0157374_10714814
209 Ga0157378_10092925
210 Ga0163162_10090114
211 Ga0157372_10580144
212 Ga0157375_10108204
213 Ga0157375_10920269
214 Ga0157380_10141269
215 Ga0157380_10344936
216 Ga0213876_10185001
217 Ga0207705_10010192
218 Ga0207705_10066710
219 Ga0207684_10197077
220 Ga0207671_10120408
221 Ga0207646_10103554
222 Ga0207644_10036239
223 Ga0207709_10055345
224 Ga0207665_10020202
225 Ga0207691_10172267
226 Ga0207658_10407750
227 Ga0207708_10284597
228 Ga0207641_10154707
229 Ga0207676_10101777
230 Ga0207676_10200027
231 Ga0207674_10223060
232 Ga0207674_10628653
233 Ga0207683_10227185
234 Ga0207698_10217047
235 Ga0207698_10633941
236 Ga0268265_10134243
237 Ga0265327_10000054
238 Ga0316578_10120165
239 Ga0307415_100369241
240 Ga0316574_0013031
241 Ga0373937_0203786
242 Ga0316582_0036600
243 Ga0316584_0005540
244 Ga0436365_1437359
245 Ga0451577_0045757
246 Ga0451577_0285331
247 Ga0466972_0000026
248 Ga0453683_0212727
249 Ga0466963_0118806
250 Ga0453684_0017222
251 Ga0453684_0066518
252 Ga0453684_0119373
253 Ga0453684_0139421
254 Ga0453684_0415086
255 Ga0466957_0073027
256 Ga0451576_0011863
257 Ga0451576_0013190
258 Ga0451576_0165894
259 Ga0451576_0184002
260 Ga0451576_0189228
261 Ga0451576_1185735
262 Ga0466958_0107394
263 Ga0496124_0113785
264 Ga0501032_0126946
265 Ga0501039_0206723
266 Ga0501039_0255120
267 Ga0501071_0049750
268 Ga0501075_0025274
269 Ga0501076_0069181
270 Ga0501076_0079000
271 Ga0501079_0296935
272 Ga0501080_0049417
273 Ga0501081_0087217
274 Ga0501081_0283993
275 Ga0501044_0045535
276 nmdc:mga05p37_1129_c1
277 nmdc:mga05p37_12000_c1
278 nmdc:mga05p37_341848_c1
279 nmdc:mga05p37_439398_c1
280 nmdc:mga09592_346973_c1
281 nmdc:mga09592_44813_c1
282 nmdc:mga0qj67_170290_c1
283 nmdc:mga06r32_52634_c1
284 nmdc:mga06r32_92838_c1
285 nmdc:mga08x19_212005_c1
286 Ga0500556_0118065
287 Ga0501084_0012118
288 Ga0501084_0053288
289 Ga0501084_0305353
290 Ga0501082_0338111
291 Ga0530510_0153037
292 2644643874
293 2645722456
294 2645725427

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

2

238

0.97

PF12804

NTP_transf_3

MobA-like NTP transferase domain

3

165

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pkq-assembly3.cif.gz_C q83d variant of s. enterica rmla with dgtp 0.9836 1 286
3pkq-assembly2.cif.gz_B q83d variant of s. enterica rmla with dgtp 0.9836 2 286
3pkq-assembly3.cif.gz_D q83d variant of s. enterica rmla with dgtp 0.9821 1 286
1lvw-assembly1.cif.gz_D crystal structure of glucose-1-phosphate thymidylyltransferase, rmla, complex with dtdp 0.9816 1 287
4hoc-assembly1.cif.gz_A crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-n-acetylglucosamine 0.9807 1 287
ID Description Score Start End Superfamily
4b2xA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9703 2 289 3.90.550.10
4b2xA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9637 2 289 3.90.550.10
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9447 1 238 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9189 1 222 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9064 1 222 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A2V9PIY8-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9986 2 117 GO:0008879
GO:0045226
AF-A0A5K1ISM2-F1-model_v4 Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) (dTDP-glucose pyrophosphorylase) (dTDP-glucose synthase) 0.998 1 80 GO:0008879
GO:0045226
AF-M6GHF5-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9967 1 87 GO:0008879
GO:0045226
AF-A0A434W677-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9963 1 144 GO:0008879
GO:0045226
AF-A0A561DDF8-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9959 1 138 GO:0008879
GO:0045226

Map