F201081

General Info

Members Datasets Scaffolds Average Seq Length
147 101 294 278

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_1304367|Ga0451853_1304367_674_1648
Length 312
Sequence VDLLDAAVTVRTWTTTLRIYPDRGAVQQERLLNPSESTRAMYGAELRHRRERAGLSQEELGAAMFVSGSFVGQLEAGVRRMQLEYAKSVDEILQTDGFFVRNLAAARQSPYRAHFADVVELEGVACTIKDWAPSSMPGLLQTPSYNRAVIRAYDPLVPEDVVEERIAFRKARARIFDSPAPPLYWAILDEVIVRRQAGSAAVMAGQLLHVAGMIRGNRIIVQVLPISAGVHAGNAGIFKLMTFDDAPPMVYCQGSESGRLLDDPSVFARSALTYDLLGAAALSPDASLALIEQAAKEYKDADRTRSEDRDLA

Samples

Sample ID Description Type Environment
1 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
4 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
5 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
6 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
7 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
8 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
9 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
10 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
11 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
12 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
13 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
14 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
15 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
16 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
17 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
18 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
19 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
20 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
21 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
22 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
23 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
24 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
25 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
26 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
27 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
28 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
29 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
30 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
31 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
32 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
33 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
34 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
35 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
36 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
37 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
38 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
39 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
40 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
41 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
42 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
43 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
44 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
45 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
46 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
47 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
48 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
49 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
50 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
51 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
52 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
53 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
54 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
55 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
56 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
57 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
58 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
59 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
63 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
65 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
71 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
73 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
74 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
75 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
76 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
77 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
78 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
79 2643221647 Streptomyces sp. Root369 Isolate Unclassified
80 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
81 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
82 2808606448 Streptomyces sp. 193411 Isolate Unclassified
83 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
84 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
85 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
86 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
87 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
88 2862574272 Streptomyces sp. AcE210 Isolate Nodule
89 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
90 2867475112 Streptomyces sp. TM32 Isolate Unclassified
91 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
92 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
93 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
94 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
95 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
96 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
97 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
98 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
99 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
100 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
101 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 81.63
Metatranscriptomes 0
Isolates 18.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.36
Nodule 3.4
Rhizoplane 0
Rhizosphere 74.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451853_1304367 3300041512 Bacteria 4284
2 JGI24739J22299_10047712 3300001989 Bacteria 1396
3 Ga0070672_100416493 3300005543 Bacteria 1153
4 Ga0105238_10211597 3300009551 Bacteria 1915
5 Ga0157372_10307223 3300013307 Bacteria 1846
6 Ga0183367_1005 3300015688 Bacteria 652063
7 Ga0207691_10410490 3300025940 Bacteria 1154
8 Ga0307515_10036054 3300028794 Bacteria 8018
9 Ga0307511_10001033 3300030521 Bacteria 29558
10 Ga0307511_10101760 3300030521 Bacteria 1881
11 Ga0307512_10005646 3300030522 Bacteria 12938
12 Ga0307513_10102042 3300031456 Bacteria 2889
13 Ga0307513_10293753 3300031456 Bacteria 1395
14 Ga0307513_10302524 3300031456 Bacteria 1365
15 Ga0307509_10004402 3300031507 Bacteria 20378
16 Ga0307508_10136843 3300031616 Bacteria 2053
17 Ga0307508_10352969 3300031616 Bacteria 1062
18 Ga0307518_10074831 3300031838 Bacteria 2449
19 Ga0307518_10255927 3300031838 Bacteria 1108
20 Ga0307507_10008855 3300033179 Bacteria 13700
21 Ga0307507_10072413 3300033179 Bacteria 3106
22 Ga0307510_10003432 3300033180 Bacteria 18479
23 Ga0307510_10102160 3300033180 Bacteria 2650
24 Ga0307510_10162216 3300033180 Bacteria 1830
25 Ga0307510_10222693 3300033180 Bacteria 1396
26 Ga0395898_0012732 3300037466 Bacteria 8688
27 Ga0395901_0793094 3300038443 Bacteria 937
28 Ga0439436_0014395 3300041404 Bacteria 2387
29 Ga0451853_0656270 3300041512 Bacteria 3503
30 Ga0451853_1055147 3300041512 Bacteria 1024
31 Ga0439449_0014231 3300042007 Bacteria 2990
32 Ga0439457_008455 3300042014 Bacteria 2427
33 Ga0439458_0004240 3300042157 Bacteria 3308
34 Ga0466965_0176157 3300044683 Bacteria 1127
35 Ga0466966_0034711 3300044684 Bacteria 3261
36 Ga0466961_0050914 3300044693 Bacteria 2645
37 Ga0466971_0018592 3300044719 Bacteria 3080
38 Ga0466967_0512333 3300045976 Bacteria 1178
39 Ga0495603_0000568 3300046455 Bacteria 20742
40 Ga0495603_0022895 3300046455 Bacteria 3781
41 Ga0495603_0058179 3300046455 Bacteria 2286
42 Ga0495603_0188869 3300046455 Bacteria 1191
43 Ga0495629_0001737 3300046459 Bacteria 17094
44 Ga0495629_0002401 3300046459 Bacteria 14408
45 Ga0495629_0003435 3300046459 Bacteria 11976
46 Ga0495629_0041775 3300046459 Bacteria 3224
47 Ga0495629_0213039 3300046459 Bacteria 1334
48 Ga0495629_0320557 3300046459 Bacteria 1059
49 Ga0495651_0067256 3300046462 Bacteria 2733
50 Ga0495639_0021102 3300046475 Bacteria 2850
51 Ga0495662_0001958 3300046476 Bacteria 10338
52 Ga0495662_0015142 3300046476 Bacteria 3746
53 Ga0495662_0022278 3300046476 Bacteria 3060
54 Ga0495664_0014863 3300046477 Bacteria 4418
55 Ga0495594_0000752 3300046499 Bacteria 16620
56 Ga0495594_0031021 3300046499 Bacteria 2896
57 Ga0495594_0332640 3300046499 Bacteria 865
58 Ga0495618_0010928 3300046514 Bacteria 5498
59 Ga0495620_0050491 3300046515 Bacteria 1774
60 Ga0495630_0293725 3300046517 Bacteria 1242
61 Ga0495666_0142206 3300046526 Bacteria 1118
62 Ga0495587_0024194 3300046536 Bacteria 3725
63 Ga0495622_0001615 3300046557 Bacteria 11129
64 Ga0495634_0001585 3300046642 Bacteria 19972
65 Ga0495625_0046823 3300046660 Bacteria 3119
66 Ga0495625_0195302 3300046660 Bacteria 1338
67 Ga0495635_0058031 3300046663 Bacteria 2663
68 Ga0495635_0086770 3300046663 Bacteria 2141
69 Ga0495588_0004841 3300046674 Bacteria 5965
70 Ga0495588_0014888 3300046674 Bacteria 3732
71 Ga0495588_0072185 3300046674 Bacteria 1795
72 Ga0495657_0016228 3300046675 Bacteria 5429
73 Ga0495657_0029889 3300046675 Bacteria 3819
74 Ga0495646_0002880 3300046680 Bacteria 10656
75 Ga0495613_0001838 3300046689 Bacteria 16148
76 Ga0495613_0015678 3300046689 Bacteria 5640
77 Ga0495613_0043458 3300046689 Bacteria 3324
78 Ga0495671_0089892 3300046692 Bacteria 1503
79 Ga0495649_0015691 3300046694 Bacteria 4307
80 Ga0495589_0016986 3300046794 Bacteria 3736
81 Ga0495600_0244847 3300046809 Bacteria 1142
82 Ga0495604_0000208 3300047317 Bacteria 53826
83 Ga0495636_0016334 3300047318 Bacteria 2964
84 Ga0495676_0013348 3300047321 Bacteria 7378
85 Ga0495676_0021157 3300047321 Bacteria 5690
86 Ga0495676_0021568 3300047321 Bacteria 5621
87 Ga0495676_0035008 3300047321 Bacteria 4205
88 Ga0495687_028876 3300047443 Bacteria 2573
89 Ga0495687_037777 3300047443 Bacteria 2148
90 Ga0495687_066500 3300047443 Bacteria 1463
91 Ga0495685_000330 3300047447 Bacteria 15270
92 Ga0495685_006751 3300047447 Bacteria 3771
93 Ga0495593_0003036 3300047673 Bacteria 10116
94 Ga0495614_0033575 3300048089 Bacteria 2207
95 Ga0495614_0060272 3300048089 Bacteria 1630
96 Ga0501031_0043221 3300049568 Bacteria 2941
97 Ga0501033_0069413 3300049570 Bacteria 2590
98 Ga0501033_0111337 3300049570 Bacteria 1992
99 Ga0501034_0025087 3300049571 Bacteria 6067
100 Ga0501036_0047555 3300049572 Bacteria 3633
101 Ga0501037_0030416 3300049573 Bacteria 3990
102 Ga0501037_0094152 3300049573 Bacteria 2166
103 Ga0501038_0141562 3300049574 Bacteria 1967
104 Ga0501039_0148921 3300049575 Bacteria 1839
105 Ga0501043_0034369 3300049579 Bacteria 3987
106 Ga0501046_0031529 3300049580 Bacteria 4295
107 Ga0501046_0155315 3300049580 Bacteria 1724
108 Ga0501047_0194855 3300049581 Bacteria 1888
109 Ga0501047_0201130 3300049581 Bacteria 1853
110 Ga0501047_0216460 3300049581 Bacteria 1772
111 Ga0501047_0246085 3300049581 Bacteria 1637
112 Ga0501048_0053862 3300049582 Bacteria 2858
113 Ga0501080_0131613 3300049742 Bacteria 2316
114 Ga0501035_0012487 3300049822 Bacteria 7847
115 Ga0501044_0018496 3300049823 Bacteria 7465
116 Ga0501044_0058711 3300049823 Bacteria 3944
117 Ga0500610_0066211 3300053079 Bacteria 1884
118 Ga0495619_0099367 3300053085 Bacteria 1979
119 Ga0500640_035743 3300053095 Bacteria 2183
120 Ga0466962_0016326 3300061719 Bacteria 3581
121 2585308870 2582581313 Bacteria 10042643
122 2585313552 2582581314 Bacteria 11452267
123 2644262352 2643221647 Bacteria 10741251
124 2785343214 2784746763 Bacteria 9783172
125 2785369580 2784746768 Bacteria 10036182
126 2809232250 2808606448 Bacteria 8656184
127 2812358016 2811994879 Bacteria 9313447
128 2819695471 2818991463 Bacteria 7948711
129 2852636585 2852635781 Bacteria 8251373
130 2862296646 2862290372 Bacteria 7471434
131 2862384415 2862382967 Bacteria 10317375
132 2862386169 2862382967 Bacteria 10317375
133 2862579187 2862574272 Bacteria 10567477
134 2863404525 2863404153 Bacteria 9672205
135 2867479891 2867475112 Bacteria 6909112
136 2873155660 2873151551 Bacteria 8625867
137 2946067827 2946064051 Bacteria 8957905
138 2954007303 2954002825 Bacteria 9173742
139 2954386157 2954380949 Bacteria 10050426
140 2954696799 2954691527 Bacteria 10720516
141 2954705339 2954701450 Bacteria 10834262
142 2966601715 2966598605 Bacteria 7676064
143 3006394644 3006393351 Bacteria 6615579
144 3006487447 3006486233 Bacteria 8157040
145 8008567209 8008558824 Bacteria 10610750
146 8008567233 8008558824 Bacteria 10610750
147 8023629804 8023623736 Bacteria 8593882
148 Ga0451853_1304367
149 JGI24739J22299_10047712
150 Ga0070672_100416493
151 Ga0105238_10211597
152 Ga0157372_10307223
153 Ga0183367_1005
154 Ga0207691_10410490
155 Ga0307515_10036054
156 Ga0307511_10001033
157 Ga0307511_10101760
158 Ga0307512_10005646
159 Ga0307513_10102042
160 Ga0307513_10293753
161 Ga0307513_10302524
162 Ga0307509_10004402
163 Ga0307508_10136843
164 Ga0307508_10352969
165 Ga0307518_10074831
166 Ga0307518_10255927
167 Ga0307507_10008855
168 Ga0307507_10072413
169 Ga0307510_10003432
170 Ga0307510_10102160
171 Ga0307510_10162216
172 Ga0307510_10222693
173 Ga0395898_0012732
174 Ga0395901_0793094
175 Ga0439436_0014395
176 Ga0451853_0656270
177 Ga0451853_1055147
178 Ga0439449_0014231
179 Ga0439457_008455
180 Ga0439458_0004240
181 Ga0466965_0176157
182 Ga0466966_0034711
183 Ga0466961_0050914
184 Ga0466971_0018592
185 Ga0466967_0512333
186 Ga0495603_0000568
187 Ga0495603_0022895
188 Ga0495603_0058179
189 Ga0495603_0188869
190 Ga0495629_0001737
191 Ga0495629_0002401
192 Ga0495629_0003435
193 Ga0495629_0041775
194 Ga0495629_0213039
195 Ga0495629_0320557
196 Ga0495651_0067256
197 Ga0495639_0021102
198 Ga0495662_0001958
199 Ga0495662_0015142
200 Ga0495662_0022278
201 Ga0495664_0014863
202 Ga0495594_0000752
203 Ga0495594_0031021
204 Ga0495594_0332640
205 Ga0495618_0010928
206 Ga0495620_0050491
207 Ga0495630_0293725
208 Ga0495666_0142206
209 Ga0495587_0024194
210 Ga0495622_0001615
211 Ga0495634_0001585
212 Ga0495625_0046823
213 Ga0495625_0195302
214 Ga0495635_0058031
215 Ga0495635_0086770
216 Ga0495588_0004841
217 Ga0495588_0014888
218 Ga0495588_0072185
219 Ga0495657_0016228
220 Ga0495657_0029889
221 Ga0495646_0002880
222 Ga0495613_0001838
223 Ga0495613_0015678
224 Ga0495613_0043458
225 Ga0495671_0089892
226 Ga0495649_0015691
227 Ga0495589_0016986
228 Ga0495600_0244847
229 Ga0495604_0000208
230 Ga0495636_0016334
231 Ga0495676_0013348
232 Ga0495676_0021157
233 Ga0495676_0021568
234 Ga0495676_0035008
235 Ga0495687_028876
236 Ga0495687_037777
237 Ga0495687_066500
238 Ga0495685_000330
239 Ga0495685_006751
240 Ga0495593_0003036
241 Ga0495614_0033575
242 Ga0495614_0060272
243 Ga0501031_0043221
244 Ga0501033_0069413
245 Ga0501033_0111337
246 Ga0501034_0025087
247 Ga0501036_0047555
248 Ga0501037_0030416
249 Ga0501037_0094152
250 Ga0501038_0141562
251 Ga0501039_0148921
252 Ga0501043_0034369
253 Ga0501046_0031529
254 Ga0501046_0155315
255 Ga0501047_0194855
256 Ga0501047_0201130
257 Ga0501047_0216460
258 Ga0501047_0246085
259 Ga0501048_0053862
260 Ga0501080_0131613
261 Ga0501035_0012487
262 Ga0501044_0018496
263 Ga0501044_0058711
264 Ga0500610_0066211
265 Ga0495619_0099367
266 Ga0500640_035743
267 Ga0466962_0016326
268 2585308870
269 2585313552
270 2644262352
271 2785343214
272 2785369580
273 2809232250
274 2812358016
275 2819695471
276 2852636585
277 2862296646
278 2862384415
279 2862386169
280 2862579187
281 2863404525
282 2867479891
283 2873155660
284 2946067827
285 2954007303
286 2954386157
287 2954696799
288 2954705339
289 2966601715
290 3006394644
291 3006487447
292 8008567209
293 8008567233
294 8023629804

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19054

DUF5753

Domain of unknown function (DUF5753)

115

293

0.99

PF13560

HTH_31

Helix-turn-helix domain

42

98

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o81-assembly1.cif.gz_AU rabbit 80s ribosome colliding in another ribosome stalled by the sars-cov-2 pseudoknot 0.7434 15 68
4x4b-assembly1.cif.gz_B radiation damage to the nucleoprotein complex c.esp1396i: dose (dwd) 2.1 mgy 0.6826 11 79
3vk0-assembly2.cif.gz_B crystal structure of hypothetical transcription factor nhtf from neisseria 0.6825 1 68
4i6u-assembly2.cif.gz_C crystal structure of a y37f mutant of the restriction-modification controller protein c.esp1396i 0.6803 13 79
3f6w-assembly1.cif.gz_A xre-family like protein from pseudomonas syringae pv. tomato str. dc3000 0.6767 10 80
ID Description Score Start End Superfamily
af_Q58006_80_170_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.742 18 69 1.10.260.40
3f51A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.6934 13 80 1.10.260.40
3hziB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.6927 14 69 1.10.260.40
af_Q8K1S1_439_537_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6896 210 236 2.130.10.10
3dnvB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.6855 14 69 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A1C4KQK9-F1-model_v4 DUF5753 domain-containing protein 0.9891 94 275
AF-D6A0J6-F1-model_v4 DNA binding protein 0.9826 94 274
AF-A0A101JLF8-F1-model_v4 DUF397 domain-containing protein 0.9727 168 274
AF-A0A4R7IJN6-F1-model_v4 deleted 0.9719 160 278
AF-A0A2G7BUB5-F1-model_v4 deleted 0.9671 83 277

Map