F200746

General Info

Members Datasets Scaffolds Average Seq Length
147 122 294 208

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10075645|Ga0307515_100756452
Length 225
Sequence MRVRPVSFDVLVEELADLISGCTAAKRGPAGRQGLSGFDGDWLRVAVDGAPAAGPGVLAEALIDPLRVRGRPAVRISADDFLRPASLRLEFGRNNPDAFYAGWLDEAGLRREVLDPAGPGGTGRILTKLWNARTDRSAREPYTQLKPGAVVLVSGPLLLGAGLPFDLAVHLELSAAALDRRTGAEERWTLPAYARYRAEVDPAAFADVVVRVDDPRHPALVLDRH

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
28 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
29 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
30 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
32 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
46 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
47 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
48 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
49 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
50 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
51 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
52 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
53 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
54 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
60 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
61 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
62 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
65 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
66 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
67 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
68 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
69 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
70 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
71 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
72 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
73 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
74 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
75 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
76 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
77 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
78 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
79 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
80 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
81 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
82 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
83 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
84 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
85 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
86 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
87 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
88 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
89 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
90 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
91 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
92 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
93 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
94 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
95 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
96 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
97 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
98 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
99 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
100 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
101 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
102 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
103 2858868258 Micromonospora sp. MH33 Isolate Unclassified
104 2858882152 Micromonospora noduli MED15 Isolate Nodule
105 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
106 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
107 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
108 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
109 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
110 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
111 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
112 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
113 2902582711 Micromonospora sp. AP08 Isolate Unclassified
114 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
115 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
116 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
117 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
118 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
119 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
120 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
121 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
122 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.63
Metatranscriptomes 0.68
Isolates 17.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.72
Nodule 2.72
Rhizoplane 6.8
Rhizosphere 57.82
Stem 0
Stem Tuber 0
Unclassified 3.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10075645 3300028794 Bacteria 4482
2 rootH1_10029623 3300003316 Bacteria 4665
3 rootH1_10182095 3300003323 Bacteria 2828
4 Ga0070658_10635171 3300005327 Bacteria 926
5 Ga0070668_100004726 3300005347 Bacteria 10099
6 Ga0070709_10238000 3300005434 Bacteria 1306
7 Ga0070714_100151720 3300005435 Bacteria 2089
8 Ga0070714_100179474 3300005435 Bacteria 1926
9 Ga0070713_100044628 3300005436 Bacteria 3629
10 Ga0070711_100118754 3300005439 Bacteria 1952
11 Ga0070663_100000664 3300005455 Bacteria 18510
12 Ga0068857_100337568 3300005577 Bacteria 1394
13 Ga0068856_100208770 3300005614 Bacteria 1968
14 Ga0068864_100003193 3300005618 Bacteria 13554
15 Ga0068863_100179819 3300005841 Bacteria 2030
16 Ga0068862_100707896 3300005844 Bacteria 976
17 Ga0081539_10000135 3300005985 Bacteria 172789
18 Ga0081539_10251921 3300005985 Bacteria 784
19 Ga0070712_100122971 3300006175 Unclassified 1955
20 Ga0075428_100008300 3300006844 Bacteria 11511
21 Ga0075428_100061526 3300006844 Bacteria 4112
22 Ga0075430_100000610 3300006846 Bacteria 27294
23 Ga0075431_100002459 3300006847 Bacteria 17840
24 Ga0075431_100180195 3300006847 Unclassified 2168
25 Ga0075429_100000625 3300006880 Bacteria 27294
26 Ga0075429_100345486 3300006880 Bacteria 1302
27 Ga0105245_10158545 3300009098 Bacteria 2146
28 Ga0114129_10001039 3300009147 Bacteria 36304
29 Ga0105248_10969370 3300009177 Bacteria 960
30 Ga0105238_10279023 3300009551 Bacteria 1652
31 Ga0105239_10322540 3300010375 Bacteria 1742
32 Ga0157373_10055364 3300013100 Bacteria 2818
33 Ga0163163_10013620 3300014325 Bacteria 7447
34 Ga0157379_10040905 3300014968 Bacteria 4138
35 Ga0206354_10455841 3300020081 Bacteria 966
36 Ga0213875_10006944 3300021388 Bacteria 5894
37 Ga0207699_10364415 3300025906 Bacteria 1023
38 Ga0207693_10202728 3300025915 Unclassified 1560
39 Ga0207663_10199299 3300025916 Unclassified 1443
40 Ga0207694_10193742 3300025924 Bacteria 1652
41 Ga0207700_10227280 3300025928 Bacteria 1585
42 Ga0207668_10007665 3300025972 Bacteria 6423
43 Ga0207678_10000059 3300026067 Bacteria 85898
44 Ga0207702_10244773 3300026078 Bacteria 1682
45 Ga0207641_10009392 3300026088 Bacteria 8061
46 Ga0207676_10007587 3300026095 Bacteria 7699
47 Ga0207674_10160952 3300026116 Unclassified 2199
48 Ga0268266_10516586 3300028379 Bacteria 1142
49 Ga0268265_10580210 3300028380 Bacteria 1069
50 Ga0307517_10092893 3300028786 Bacteria 2451
51 Ga0307515_10001375 3300028794 Bacteria 55075
52 Ga0307515_10010203 3300028794 Bacteria 18040
53 Ga0307515_10027903 3300028794 Bacteria 9621
54 Ga0307512_10011031 3300030522 Bacteria 8583
55 Ga0307512_10012141 3300030522 Bacteria 8144
56 Ga0307512_10070905 3300030522 Bacteria 2591
57 Ga0265328_10014013 3300031239 Bacteria 3164
58 Ga0307513_10005590 3300031456 Bacteria 16582
59 Ga0307513_10091631 3300031456 Bacteria 3097
60 Ga0307513_10229131 3300031456 Bacteria 1672
61 Ga0307513_10614102 3300031456 Bacteria 796
62 Ga0307509_10168495 3300031507 Bacteria 2074
63 Ga0307408_100240610 3300031548 Bacteria 1487
64 Ga0307508_10043162 3300031616 Bacteria 4041
65 Ga0307516_10001067 3300031730 Bacteria 38191
66 Ga0307516_10005843 3300031730 Bacteria 14579
67 Ga0307405_10238371 3300031731 Bacteria 1346
68 Ga0307413_10069437 3300031824 Bacteria 2211
69 Ga0307410_10023945 3300031852 Bacteria 3807
70 Ga0307410_10077090 3300031852 Bacteria 2329
71 Ga0307406_10160932 3300031901 Bacteria 1613
72 Ga0307406_10786427 3300031901 Bacteria 802
73 Ga0307409_100039112 3300031995 Bacteria 3516
74 Ga0307416_100009855 3300032002 Bacteria 6280
75 Ga0307416_100049448 3300032002 Bacteria 3343
76 Ga0307416_100210906 3300032002 Bacteria 1853
77 Ga0307414_10453329 3300032004 Bacteria 1125
78 Ga0307415_100002455 3300032126 Bacteria 9249
79 Ga0307415_100138384 3300032126 Bacteria 1855
80 Ga0307415_100569108 3300032126 Bacteria 1003
81 Ga0307510_10100990 3300033180 Bacteria 2676
82 Ga0307510_10188595 3300033180 Bacteria 1613
83 Ga0373931_0285759 3300035691 Bacteria 1014
84 Ga0395900_0100085 3300037418 Bacteria 2977
85 Ga0436364_0014417 3300037853 Bacteria 52893
86 Ga0439463_005767 3300042016 Bacteria 3073
87 Ga0466969_0036619 3300044656 Bacteria 2478
88 Ga0466972_0034025 3300044658 Bacteria 2499
89 Ga0466965_0205907 3300044683 Bacteria 1045
90 Ga0466970_0477969 3300044765 Bacteria 716
91 Ga0466958_0220613 3300045836 Bacteria 1210
92 Ga0495638_0107557 3300046460 Bacteria 1660
93 Ga0495606_0001338 3300046507 Bacteria 33545
94 Ga0495668_0000386 3300046616 Bacteria 58109
95 Ga0495625_0000856 3300046660 Bacteria 41373
96 Ga0495683_0037062 3300047323 Bacteria 2474
97 Ga0495626_0001473 3300048091 Bacteria 18593
98 Ga0496102_0003045 3300048905 Bacteria 14204
99 Ga0496103_0059622 3300048906 Bacteria 2371
100 Ga0496104_0030212 3300048907 Bacteria 5033
101 Ga0496109_0001906 3300048912 Bacteria 17324
102 Ga0496110_0021364 3300048913 Bacteria 5478
103 Ga0496111_0274375 3300048914 Bacteria 1251
104 Ga0496112_0182453 3300048915 Bacteria 2062
105 Ga0496112_0338182 3300048915 Bacteria 1449
106 Ga0496113_0006668 3300048916 Bacteria 7347
107 Ga0496113_0183007 3300048916 Bacteria 1661
108 Ga0496123_0000166 3300048926 Bacteria 131527
109 Ga0496124_0001432 3300048927 Bacteria 35312
110 Ga0501042_0195783 3300049578 Bacteria 1458
111 nmdc:mga06z11_265128_c1 3300050494 Bacteria 1014
112 nmdc:mga05p37_179424_c1 3300050507 Bacteria 2577
113 nmdc:mga05p37_790_c1 3300050507 Bacteria 35216
114 nmdc:mga09592_327914_c1 3300050508 Bacteria 1326
115 nmdc:mga09592_3_c1 3300050508 Bacteria 144376
116 nmdc:mga0qj67_17_c1 3300050509 Bacteria 121673
117 nmdc:mga06r32_385_c1 3300050510 Bacteria 37158
118 Ga0500644_0094059 3300053088 Bacteria 1127
119 Ga0500594_0012643 3300053118 Bacteria 1994
120 Ga0500588_0205078 3300053146 Bacteria 731
121 Ga0530510_0712630 3300061734 Bacteria 765
122 2586059515 2585427649 Bacteria 9053857
123 2831935969 2831935698 Bacteria 5963223
124 2832009273 2832004796 Bacteria 6538017
125 2839988056 2839986021 Bacteria 3685650
126 2857292477 2857288857 Bacteria 7189066
127 2858851555 2858848962 Bacteria 6963058
128 2858872402 2858868258 Bacteria 7683772
129 2858887432 2858882152 Bacteria 7230291
130 2858897208 2858895516 Bacteria 7378898
131 2866068327 2866065130 Bacteria 6518152
132 2867303263 2867302475 Bacteria 7087181
133 2867318313 2867312974 Bacteria 7058875
134 2867319514 2867319477 Bacteria 7069771
135 2873317746 2873314349 Bacteria 8512634
136 2880500867 2880495981 Bacteria 7340502
137 2899363482 2899359706 Bacteria 10940472
138 2902584762 2902582711 Bacteria 6187705
139 2929229380 2929226422 Bacteria 7248583
140 2996226441 2996221748 Bacteria 6799777
141 8001785947 8001781756 Bacteria 9586736
142 8003321892 8003314358 Bacteria 10575343
143 8003861443 8003856774 Bacteria 7675274
144 8054732630 8054727385 Bacteria 7558670
145 8054737858 8054734606 Bacteria 6947278
146 8055173958 8055172936 Bacteria 9305943
147 8055415759 8055412473 Bacteria 6257500
148 Ga0307515_10075645
149 rootH1_10029623
150 rootH1_10182095
151 Ga0070658_10635171
152 Ga0070668_100004726
153 Ga0070709_10238000
154 Ga0070714_100151720
155 Ga0070714_100179474
156 Ga0070713_100044628
157 Ga0070711_100118754
158 Ga0070663_100000664
159 Ga0068857_100337568
160 Ga0068856_100208770
161 Ga0068864_100003193
162 Ga0068863_100179819
163 Ga0068862_100707896
164 Ga0081539_10000135
165 Ga0081539_10251921
166 Ga0070712_100122971
167 Ga0075428_100008300
168 Ga0075428_100061526
169 Ga0075430_100000610
170 Ga0075431_100002459
171 Ga0075431_100180195
172 Ga0075429_100000625
173 Ga0075429_100345486
174 Ga0105245_10158545
175 Ga0114129_10001039
176 Ga0105248_10969370
177 Ga0105238_10279023
178 Ga0105239_10322540
179 Ga0157373_10055364
180 Ga0163163_10013620
181 Ga0157379_10040905
182 Ga0206354_10455841
183 Ga0213875_10006944
184 Ga0207699_10364415
185 Ga0207693_10202728
186 Ga0207663_10199299
187 Ga0207694_10193742
188 Ga0207700_10227280
189 Ga0207668_10007665
190 Ga0207678_10000059
191 Ga0207702_10244773
192 Ga0207641_10009392
193 Ga0207676_10007587
194 Ga0207674_10160952
195 Ga0268266_10516586
196 Ga0268265_10580210
197 Ga0307517_10092893
198 Ga0307515_10001375
199 Ga0307515_10010203
200 Ga0307515_10027903
201 Ga0307512_10011031
202 Ga0307512_10012141
203 Ga0307512_10070905
204 Ga0265328_10014013
205 Ga0307513_10005590
206 Ga0307513_10091631
207 Ga0307513_10229131
208 Ga0307513_10614102
209 Ga0307509_10168495
210 Ga0307408_100240610
211 Ga0307508_10043162
212 Ga0307516_10001067
213 Ga0307516_10005843
214 Ga0307405_10238371
215 Ga0307413_10069437
216 Ga0307410_10023945
217 Ga0307410_10077090
218 Ga0307406_10160932
219 Ga0307406_10786427
220 Ga0307409_100039112
221 Ga0307416_100009855
222 Ga0307416_100049448
223 Ga0307416_100210906
224 Ga0307414_10453329
225 Ga0307415_100002455
226 Ga0307415_100138384
227 Ga0307415_100569108
228 Ga0307510_10100990
229 Ga0307510_10188595
230 Ga0373931_0285759
231 Ga0395900_0100085
232 Ga0436364_0014417
233 Ga0439463_005767
234 Ga0466969_0036619
235 Ga0466972_0034025
236 Ga0466965_0205907
237 Ga0466970_0477969
238 Ga0466958_0220613
239 Ga0495638_0107557
240 Ga0495606_0001338
241 Ga0495668_0000386
242 Ga0495625_0000856
243 Ga0495683_0037062
244 Ga0495626_0001473
245 Ga0496102_0003045
246 Ga0496103_0059622
247 Ga0496104_0030212
248 Ga0496109_0001906
249 Ga0496110_0021364
250 Ga0496111_0274375
251 Ga0496112_0182453
252 Ga0496112_0338182
253 Ga0496113_0006668
254 Ga0496113_0183007
255 Ga0496123_0000166
256 Ga0496124_0001432
257 Ga0501042_0195783
258 nmdc:mga06z11_265128_c1
259 nmdc:mga05p37_179424_c1
260 nmdc:mga05p37_790_c1
261 nmdc:mga09592_327914_c1
262 nmdc:mga09592_3_c1
263 nmdc:mga0qj67_17_c1
264 nmdc:mga06r32_385_c1
265 Ga0500644_0094059
266 Ga0500594_0012643
267 Ga0500588_0205078
268 Ga0530510_0712630
269 2586059515
270 2831935969
271 2832009273
272 2839988056
273 2857292477
274 2858851555
275 2858872402
276 2858887432
277 2858897208
278 2866068327
279 2867303263
280 2867318313
281 2867319514
282 2873317746
283 2880500867
284 2899363482
285 2902584762
286 2929229380
287 2996226441
288 8001785947
289 8003321892
290 8003861443
291 8054732630
292 8054737858
293 8055173958
294 8055415759

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rz3-assembly1.cif.gz_A structure of a possible uridine kinase from bacillus stearothermophilus 0.778 11 202
1rz3-assembly1.cif.gz_A structure of a possible uridine kinase from bacillus stearothermophilus 0.7634 11 202
3c8u-assembly1.cif.gz_A crystal structure of putative fructose transport system kinase (yp_612366.1) from silicibacter sp. tm1040 at 1.95 a resolution 0.7196 12 191
5xmb-assembly2.cif.gz_C mycobacterium tuberculosis pantothenate kinase mutant f247a 0.7086 10 217
5xmb-assembly2.cif.gz_D mycobacterium tuberculosis pantothenate kinase mutant f247a 0.6904 1 217
ID Description Score Start End Superfamily
1rz3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7735 12 202 3.40.50.300
1rz3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7584 12 202 3.40.50.300
af_Q4DA36_188_506_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6953 36 83 3.40.50.300
af_P0A8F4_7_213_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6617 34 205 3.40.50.300
2xvzA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6578 10 59 3.40.50.1400
ID Description Score Start End GO Terms
AF-I0HC95-F1-model_v4 Putative phosphoribulokinase/uridine kinase 0.9816 1 217 GO:0016301
AF-A0A3N2G1U5-F1-model_v4 Uridine kinase 0.9768 1 215
AF-A0A7X0KZZ8-F1-model_v4 Uridine kinase 0.9761 1 216
AF-A0A7W0L9H8-F1-model_v4 Uridine kinase 0.9751 2 218 GO:0016301
AF-A0A6G3XET7-F1-model_v4 Uridine kinase 0.9745 46 215 GO:0016301

Map