F200667

General Info

Members Datasets Scaffolds Average Seq Length
147 100 294 162

Family's Representative Sequence

Representative Sequence 3300028573|Ga0265334_10068047|Ga0265334_100680473
Length 192
Sequence MALDDFDRALIAATQGGLPLVPRPYDAVGERLGVSGQQVRERLAQMLEIGLVRRIGAVPNHYRLGFTANGMSVWNVDDAQVDALGERIGQLPGVSHCYRRPRHLPKASPGRSQDAESPSGGDGVQSTASGGIYWPYNLFAMLHGRSRAEVEQQAAQVQQLLGAACTGHDILYSTAILKKTGLRLKNTSVQES

Samples

Sample ID Description Type Environment
1 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
18 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
19 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
23 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
24 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
33 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
34 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
37 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
38 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
39 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
40 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
41 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
42 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
43 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
44 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
45 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
46 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
47 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
48 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
49 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
50 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
51 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
52 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
53 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
54 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
55 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
56 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
57 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
58 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
61 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
62 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
63 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
64 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
65 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
66 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
70 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
71 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
72 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
81 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
82 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
83 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
84 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
85 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
86 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
87 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
88 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
89 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
90 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
91 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
92 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
93 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
94 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
95 2547132374 Acidovorax radicis N35 Isolate Unclassified
96 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
97 2643221596 Acidovorax sp. Root70 Isolate Unclassified
98 2643221717 Acidovorax sp. Root267 Isolate Unclassified
99 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
100 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.92
Metatranscriptomes 0
Isolates 4.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.76
Nodule 0
Rhizoplane 0
Rhizosphere 90.48
Stem 0
Stem Tuber 0.68
Unclassified 2.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265334_10068047 3300028573 Bacteria 1330
2 Ga0065707_10117802 3300005295 Bacteria 2200
3 Ga0070670_100687632 3300005331 Bacteria 919
4 Ga0070680_100013238 3300005336 Bacteria 6422
5 Ga0070692_10103820 3300005345 Bacteria 1562
6 Ga0070669_100178043 3300005353 Bacteria 1662
7 Ga0070675_100224470 3300005354 Bacteria 1637
8 Ga0070673_100776891 3300005364 Bacteria 883
9 Ga0070688_100407055 3300005365 Bacteria 1008
10 Ga0070663_100114143 3300005455 Bacteria 2034
11 Ga0068853_100253740 3300005539 Bacteria 1615
12 Ga0070672_101077044 3300005543 Bacteria 714
13 Ga0068864_100662418 3300005618 Bacteria 1017
14 Ga0068864_101054155 3300005618 Bacteria 808
15 Ga0068858_100271386 3300005842 Bacteria 1614
16 Ga0068862_100679028 3300005844 Bacteria 996
17 Ga0081455_10209419 3300005937 Bacteria 1454
18 Ga0075432_10199411 3300006058 Bacteria 791
19 Ga0075366_10035734 3300006195 Bacteria 2930
20 Ga0075366_10274962 3300006195 Bacteria 1029
21 Ga0075366_10377074 3300006195 Bacteria 872
22 Ga0075370_10011780 3300006353 Bacteria 4603
23 Ga0075430_100257786 3300006846 Bacteria 1444
24 Ga0075430_100988547 3300006846 Bacteria 693
25 Ga0111539_10377518 3300009094 Bacteria 1650
26 Ga0157339_1067342 3300012505 Bacteria 510
27 Ga0163162_11587220 3300013306 Bacteria 746
28 Ga0157375_10295524 3300013308 Bacteria 1783
29 Ga0157380_10781829 3300014326 Bacteria 969
30 Ga0157379_10030743 3300014968 Bacteria 4783
31 Ga0207681_10231606 3300025923 Bacteria 1434
32 Ga0207706_10157045 3300025933 Bacteria 2000
33 Ga0207706_10452514 3300025933 Bacteria 1110
34 Ga0207691_10295818 3300025940 Bacteria 1392
35 Ga0207703_10595975 3300026035 Bacteria 1045
36 Ga0207676_10072728 3300026095 Bacteria 2765
37 Ga0207676_11335902 3300026095 Bacteria 712
38 Ga0209982_1010249 3300027552 Bacteria 1388
39 Ga0209983_1086162 3300027665 Bacteria 706
40 Ga0209974_10016311 3300027876 Bacteria 2467
41 Ga0209974_10052174 3300027876 Bacteria 1376
42 Ga0268265_11486802 3300028380 Bacteria 681
43 Ga0265330_10000045 3300031235 Bacteria 109977
44 Ga0265332_10000031 3300031238 Bacteria 162330
45 Ga0265332_10000033 3300031238 Bacteria 153334
46 Ga0265320_10220701 3300031240 Bacteria 844
47 Ga0265325_10009750 3300031241 Bacteria 5597
48 Ga0265340_10043548 3300031247 Bacteria 2199
49 Ga0265339_10015858 3300031249 Bacteria 4507
50 Ga0265327_10000679 3300031251 Bacteria 54644
51 Ga0265327_10154738 3300031251 Bacteria 1063
52 Ga0265316_10008976 3300031344 Bacteria 9220
53 Ga0307509_10000105 3300031507 Bacteria 119065
54 Ga0307408_101380932 3300031548 Bacteria 663
55 Ga0316575_10036093 3300031665 Bacteria 1944
56 Ga0316579_10018074 3300031691 Bacteria 3099
57 Ga0316579_10107163 3300031691 Bacteria 1340
58 Ga0265314_10000095 3300031711 Bacteria 134372
59 Ga0316576_10044962 3300031727 Bacteria 3191
60 Ga0316578_10125384 3300031728 Bacteria 1544
61 Ga0316577_10054642 3300031733 Bacteria 2228
62 Ga0316577_10134010 3300031733 Bacteria 1394
63 Ga0316585_10029627 3300032137 Bacteria 1715
64 Ga0373932_0032788 3300035112 Bacteria 1455
65 Ga0316574_0344093 3300035398 Unclassified 944
66 Ga0373931_0987279 3300035691 Bacteria 569
67 Ga0316582_0005194 3300036647 Bacteria 6671
68 Ga0316584_0026764 3300036712 Bacteria 4241
69 Ga0316584_1013325 3300036712 Unclassified 554
70 Ga0373925_0008884 3300037068 Bacteria 7323
71 Ga0395905_0003508 3300037471 Bacteria 16733
72 Ga0316581_0012253 3300037588 Bacteria 2412
73 Ga0316581_0076430 3300037588 Bacteria 1029
74 Ga0439443_014577 3300042003 Bacteria 1186
75 Ga0450900_017814 3300042136 Bacteria 971
76 Ga0439446_0060977 3300042156 Bacteria 1140
77 Ga0439446_0155298 3300042156 Bacteria 754
78 Ga0439434_0007357 3300042435 Bacteria 3227
79 Ga0439435_0002296 3300042436 Bacteria 3765
80 Ga0439435_0113729 3300042436 Bacteria 842
81 Ga0439444_0012843 3300042437 Bacteria 1379
82 Ga0451577_0001940 3300042876 Bacteria 26066
83 Ga0451577_0301581 3300042876 Bacteria 1452
84 Ga0451577_0847033 3300042876 Bacteria 825
85 Ga0451577_1086586 3300042876 Bacteria 716
86 Ga0451577_1294686 3300042876 Bacteria 648
87 Ga0453684_0001349 3300044712 Bacteria 71826
88 Ga0453684_0005407 3300044712 Bacteria 25330
89 Ga0453684_0305959 3300044712 Bacteria 1805
90 Ga0453684_0879764 3300044712 Bacteria 961
91 Ga0453684_1214501 3300044712 Bacteria 791
92 Ga0453684_1587994 3300044712 Unclassified 672
93 Ga0451576_0009588 3300045051 Bacteria 11207
94 Ga0451576_0013429 3300045051 Bacteria 9164
95 Ga0451576_0128716 3300045051 Bacteria 2639
96 Ga0451576_0150032 3300045051 Bacteria 2431
97 Ga0451576_0631552 3300045051 Bacteria 1125
98 Ga0451576_2276853 3300045051 Bacteria 555
99 Ga0495586_0022696 3300046535 Bacteria 3349
100 Ga0495658_0358473 3300046683 Bacteria 927
101 Ga0501033_0175090 3300049570 Bacteria 1540
102 Ga0501036_0262252 3300049572 Bacteria 1447
103 Ga0501036_1502498 3300049572 Archaea 545
104 Ga0501037_0519174 3300049573 Bacteria 806
105 Ga0501037_0820759 3300049573 Bacteria 613
106 Ga0501039_0223809 3300049575 Bacteria 1479
107 Ga0501040_0037770 3300049576 Bacteria 3282
108 Ga0501040_0054583 3300049576 Bacteria 2739
109 Ga0501041_0087586 3300049577 Bacteria 1922
110 Ga0501042_0364144 3300049578 Bacteria 1046
111 Ga0501042_0437267 3300049578 Bacteria 948
112 Ga0501042_0699998 3300049578 Bacteria 737
113 Ga0501046_0143771 3300049580 Bacteria 1803
114 Ga0501067_0121227 3300049583 Bacteria 1455
115 Ga0501071_1159847 3300049587 Bacteria 597
116 Ga0501074_0154994 3300049590 Bacteria 1637
117 Ga0501074_0584693 3300049590 Bacteria 790
118 Ga0501074_1033352 3300049590 Bacteria 578
119 Ga0501075_0242775 3300049591 Bacteria 1373
120 Ga0501075_0316821 3300049591 Bacteria 1189
121 Ga0501076_0371512 3300049592 Bacteria 1175
122 Ga0501076_0487068 3300049592 Bacteria 1016
123 Ga0501076_0728935 3300049592 Bacteria 818
124 Ga0501076_0756898 3300049592 Bacteria 802
125 Ga0501077_0203956 3300049593 Bacteria 1256
126 Ga0501081_0026108 3300049743 Bacteria 3935
127 Ga0501045_0129092 3300049824 Bacteria 1879
128 Ga0501045_0509236 3300049824 Bacteria 894
129 Ga0501045_0788303 3300049824 Bacteria 700
130 nmdc:mga0k408_74270_c1 3300050493 Bacteria 1986
131 nmdc:mga0k408_77960_c1 3300050493 Bacteria 1938
132 nmdc:mga07m45_26642_c1 3300050496 Bacteria 3178
133 nmdc:mga0qj67_1039230_c1 3300050509 Bacteria 642
134 nmdc:mga0qj67_251343_c1 3300050509 Bacteria 1434
135 nmdc:mga0qj67_345489_c1 3300050509 Bacteria 1203
136 nmdc:mga06r32_1495038_c1 3300050510 Bacteria 616
137 nmdc:mga0n895_301614_c1 3300050512 Bacteria 1624
138 Ga0501084_0146892 3300054114 Bacteria 1986
139 Ga0501084_0881275 3300054114 Bacteria 753
140 Ga0501082_0354655 3300060353 Bacteria 1279
141 Ga0501082_1581227 3300060353 Bacteria 572
142 2548498625 2547132374 Bacteria 5530232
143 2574431391 2574179768 Bacteria 4907129
144 2643990637 2643221596 Bacteria 5006805
145 2644649360 2643221717 Bacteria 5676132
146 2855021402 2855020534 Bacteria 3204685
147 8001523737 8001522603 Bacteria 4726425
148 Ga0265334_10068047
149 Ga0065707_10117802
150 Ga0070670_100687632
151 Ga0070680_100013238
152 Ga0070692_10103820
153 Ga0070669_100178043
154 Ga0070675_100224470
155 Ga0070673_100776891
156 Ga0070688_100407055
157 Ga0070663_100114143
158 Ga0068853_100253740
159 Ga0070672_101077044
160 Ga0068864_100662418
161 Ga0068864_101054155
162 Ga0068858_100271386
163 Ga0068862_100679028
164 Ga0081455_10209419
165 Ga0075432_10199411
166 Ga0075366_10035734
167 Ga0075366_10274962
168 Ga0075366_10377074
169 Ga0075370_10011780
170 Ga0075430_100257786
171 Ga0075430_100988547
172 Ga0111539_10377518
173 Ga0157339_1067342
174 Ga0163162_11587220
175 Ga0157375_10295524
176 Ga0157380_10781829
177 Ga0157379_10030743
178 Ga0207681_10231606
179 Ga0207706_10157045
180 Ga0207706_10452514
181 Ga0207691_10295818
182 Ga0207703_10595975
183 Ga0207676_10072728
184 Ga0207676_11335902
185 Ga0209982_1010249
186 Ga0209983_1086162
187 Ga0209974_10016311
188 Ga0209974_10052174
189 Ga0268265_11486802
190 Ga0265330_10000045
191 Ga0265332_10000031
192 Ga0265332_10000033
193 Ga0265320_10220701
194 Ga0265325_10009750
195 Ga0265340_10043548
196 Ga0265339_10015858
197 Ga0265327_10000679
198 Ga0265327_10154738
199 Ga0265316_10008976
200 Ga0307509_10000105
201 Ga0307408_101380932
202 Ga0316575_10036093
203 Ga0316579_10018074
204 Ga0316579_10107163
205 Ga0265314_10000095
206 Ga0316576_10044962
207 Ga0316578_10125384
208 Ga0316577_10054642
209 Ga0316577_10134010
210 Ga0316585_10029627
211 Ga0373932_0032788
212 Ga0316574_0344093
213 Ga0373931_0987279
214 Ga0316582_0005194
215 Ga0316584_0026764
216 Ga0316584_1013325
217 Ga0373925_0008884
218 Ga0395905_0003508
219 Ga0316581_0012253
220 Ga0316581_0076430
221 Ga0439443_014577
222 Ga0450900_017814
223 Ga0439446_0060977
224 Ga0439446_0155298
225 Ga0439434_0007357
226 Ga0439435_0002296
227 Ga0439435_0113729
228 Ga0439444_0012843
229 Ga0451577_0001940
230 Ga0451577_0301581
231 Ga0451577_0847033
232 Ga0451577_1086586
233 Ga0451577_1294686
234 Ga0453684_0001349
235 Ga0453684_0005407
236 Ga0453684_0305959
237 Ga0453684_0879764
238 Ga0453684_1214501
239 Ga0453684_1587994
240 Ga0451576_0009588
241 Ga0451576_0013429
242 Ga0451576_0128716
243 Ga0451576_0150032
244 Ga0451576_0631552
245 Ga0451576_2276853
246 Ga0495586_0022696
247 Ga0495658_0358473
248 Ga0501033_0175090
249 Ga0501036_0262252
250 Ga0501036_1502498
251 Ga0501037_0519174
252 Ga0501037_0820759
253 Ga0501039_0223809
254 Ga0501040_0037770
255 Ga0501040_0054583
256 Ga0501041_0087586
257 Ga0501042_0364144
258 Ga0501042_0437267
259 Ga0501042_0699998
260 Ga0501046_0143771
261 Ga0501067_0121227
262 Ga0501071_1159847
263 Ga0501074_0154994
264 Ga0501074_0584693
265 Ga0501074_1033352
266 Ga0501075_0242775
267 Ga0501075_0316821
268 Ga0501076_0371512
269 Ga0501076_0487068
270 Ga0501076_0728935
271 Ga0501076_0756898
272 Ga0501077_0203956
273 Ga0501081_0026108
274 Ga0501045_0129092
275 Ga0501045_0509236
276 Ga0501045_0788303
277 nmdc:mga0k408_74270_c1
278 nmdc:mga0k408_77960_c1
279 nmdc:mga07m45_26642_c1
280 nmdc:mga0qj67_1039230_c1
281 nmdc:mga0qj67_251343_c1
282 nmdc:mga0qj67_345489_c1
283 nmdc:mga06r32_1495038_c1
284 nmdc:mga0n895_301614_c1
285 Ga0501084_0146892
286 Ga0501084_0881275
287 Ga0501082_0354655
288 Ga0501082_1581227
289 2548498625
290 2574431391
291 2643990637
292 2644649360
293 2855021402
294 8001523737

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22451

NirdL-like_HTH

Siroheme decarboxylase NirDL-like HTH domain

7

53

0.99

PF13404

HTH_AsnC-type

AsnC-type helix-turn-helix domain

3

47

0.97

PF17805

AsnC_trans_reg2

AsnC-like ligand binding domain

63

178

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2djw-assembly1.cif.gz_F crystal structure of ttha0845 from thermus thermophilus hb8 0.8812 68 146
2e1a-assembly1.cif.gz_B crystal structure of ffrp-dm1 0.8684 68 146
1i1g-assembly1.cif.gz_A crystal structure of the lrp-like transcriptional regulator from the archaeon pyrococcus furiosus 0.8473 3 151
1i1g-assembly1.cif.gz_A crystal structure of the lrp-like transcriptional regulator from the archaeon pyrococcus furiosus 0.8419 3 151
2e1a-assembly1.cif.gz_B crystal structure of ffrp-dm1 0.8379 68 146
ID Description Score Start End Superfamily
4czcA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8867 69 148 3.30.70.3460
2cg4B02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.8737 58 146 3.30.70.920
2djwE01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.869 68 146 3.30.70.920
2cg4B02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.8643 58 146 3.30.70.920
2djwE01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.8482 68 146 3.30.70.920
ID Description Score Start End GO Terms
AF-A0A7V0WL77-F1-model_v4 Lrp/AsnC family transcriptional regulator 0.9333 54 157
AF-A7C6P3-F1-model_v4 deleted 0.9139 72 158
AF-A0A1G0ZBH1-F1-model_v4 Radical SAM core domain-containing protein 0.9111 1 146 GO:0016829
GO:0046872
GO:0051536
AF-A0A7V0WL77-F1-model_v4 Lrp/AsnC family transcriptional regulator 0.9081 54 157
AF-A0A0D0NDK7-F1-model_v4 Nitrite reductase 0.9076 50 157

Map