F200469

General Info

Members Datasets Scaffolds Average Seq Length
147 107 294 136

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10062940|Ga0213876_100629403
Length 156
Sequence LESRLEATRASVGAQYDPVAPPIEITPVGVVRSTLRDRRAAPRQAFEGAPEARLEIDPRFAPALDRVTAGAELIVVTWLHEADRTVLQVHPRDDERIPLTGVFATRSSDRPNPVGLHRVTVIGIDPPTSVRVEALEAIDGTPILDLKVAMKQSPDA

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
52 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
70 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
71 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
72 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
73 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
75 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
76 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
77 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
83 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
84 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
85 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
86 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
91 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
94 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
97 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
98 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
99 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
100 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
101 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.4
Nodule 0
Rhizoplane 2.04
Rhizosphere 87.07
Stem 0
Stem Tuber 0
Unclassified 12.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10062940 3300021384 Bacteria 1959
2 JGI24751J29686_10004271 3300002459 Bacteria 2901
3 rootH2_10255297 3300003320 Unclassified 1148
4 Ga0070683_100043091 3300005329 Bacteria 4159
5 Ga0070670_100552947 3300005331 Bacteria 1027
6 Ga0070670_100641821 3300005331 Bacteria 952
7 Ga0068869_100770672 3300005334 Bacteria 825
8 Ga0070682_100484019 3300005337 Bacteria 955
9 Ga0070661_100079283 3300005344 Bacteria 2423
10 Ga0070675_100249823 3300005354 Bacteria 1552
11 Ga0070674_100342710 3300005356 Bacteria 1204
12 Ga0070709_10263027 3300005434 Bacteria 1247
13 Ga0070714_100448478 3300005435 Bacteria 1225
14 Ga0070705_100041569 3300005440 Bacteria 2622
15 Ga0070708_100438574 3300005445 Bacteria 1232
16 Ga0070678_100031799 3300005456 Bacteria 3646
17 Ga0070685_10036707 3300005466 Bacteria 2771
18 Ga0070699_100660441 3300005518 Bacteria 954
19 Ga0070684_100322629 3300005535 Bacteria 1419
20 Ga0070696_100139375 3300005546 Bacteria 1771
21 Ga0068855_100030322 3300005563 Bacteria 6470
22 Ga0070664_100001112 3300005564 Bacteria 21281
23 Ga0070664_101525910 3300005564 Unclassified 632
24 Ga0068857_100260646 3300005577 Bacteria 1591
25 Ga0068866_10284242 3300005718 Bacteria 1026
26 Ga0068870_10030856 3300005840 Bacteria 2712
27 Ga0081539_10061287 3300005985 Bacteria 2062
28 Ga0070717_10259637 3300006028 Unclassified 1537
29 Ga0075365_10004052 3300006038 Bacteria 7688
30 Ga0075364_10116675 3300006051 Bacteria 1785
31 Ga0075367_10497039 3300006178 Bacteria 774
32 Ga0097621_100568649 3300006237 Bacteria 1033
33 Ga0068871_100311882 3300006358 Bacteria 1383
34 Ga0075428_100127837 3300006844 Bacteria 2765
35 Ga0075428_101606400 3300006844 Bacteria 680
36 Ga0075430_100300093 3300006846 Bacteria 1329
37 Ga0075430_101130411 3300006846 Bacteria 645
38 Ga0075431_101533334 3300006847 Bacteria 625
39 Ga0075433_10062156 3300006852 Bacteria 3271
40 Ga0075434_100330913 3300006871 Bacteria 1544
41 Ga0105240_10096693 3300009093 Bacteria 3598
42 Ga0111539_10107782 3300009094 Bacteria 3269
43 Ga0111539_11367008 3300009094 Unclassified 822
44 Ga0105245_10066435 3300009098 Bacteria 3264
45 Ga0105245_10084962 3300009098 Bacteria 2900
46 Ga0114129_10034725 3300009147 Bacteria 7125
47 Ga0105243_10052820 3300009148 Bacteria 3221
48 Ga0105242_10026646 3300009176 Bacteria 4582
49 Ga0105239_10000046 3300010375 Bacteria 181115
50 Ga0105246_10036399 3300011119 Bacteria 3297
51 Ga0157378_10706838 3300013297 Bacteria 1028
52 Ga0163163_13113095 3300014325 Unclassified 517
53 Ga0157380_10094184 3300014326 Bacteria 2478
54 Ga0182008_10668150 3300014497 Unclassified 590
55 Ga0157379_10742607 3300014968 Bacteria 923
56 Ga0157376_10145166 3300014969 Bacteria 2133
57 Ga0213874_10116970 3300021377 Bacteria 902
58 Ga0207643_10080200 3300025908 Bacteria 1890
59 Ga0207695_10844148 3300025913 Bacteria 796
60 Ga0207649_10065033 3300025920 Bacteria 2308
61 Ga0207650_10011585 3300025925 Bacteria 6073
62 Ga0207650_11606280 3300025925 Bacteria 552
63 Ga0207659_10209931 3300025926 Bacteria 1560
64 Ga0207687_10027424 3300025927 Bacteria 3821
65 Ga0207687_10109091 3300025927 Bacteria 2050
66 Ga0207664_10397697 3300025929 Bacteria 1225
67 Ga0207686_10050011 3300025934 Bacteria 2598
68 Ga0207709_10073579 3300025935 Bacteria 2178
69 Ga0207691_10405736 3300025940 Bacteria 1162
70 Ga0207689_10009891 3300025942 Bacteria 8222
71 Ga0207661_10030086 3300025944 Bacteria 4178
72 Ga0207679_10000437 3300025945 Bacteria 29428
73 Ga0207667_10099769 3300025949 Bacteria 2996
74 Ga0207674_10102854 3300026116 Bacteria 2836
75 Ga0207674_10116142 3300026116 Bacteria 2647
76 Ga0207683_10013085 3300026121 Bacteria 7077
77 Ga0207428_10807386 3300027907 Bacteria 666
78 Ga0373926_0183820 3300035083 Bacteria 802
79 Ga0373932_0000454 3300035112 Bacteria 12519
80 Ga0373927_0518694 3300035695 Bacteria 788
81 Ga0373947_0084059 3300035725 Bacteria 1975
82 Ga0373925_0121506 3300037068 Bacteria 2028
83 Ga0436364_0225304 3300037853 Bacteria 504
84 Ga0436365_0693811 3300039437 Bacteria 3737
85 Ga0436365_1597781 3300039437 Bacteria 8639
86 Ga0436365_1880636 3300039437 Bacteria 4302
87 Ga0436363_0793132 3300039450 Bacteria 3211
88 Ga0436363_0802067 3300039450 Bacteria 1746
89 Ga0436363_0828554 3300039450 Bacteria 2117
90 Ga0436363_1031446 3300039450 Bacteria 869
91 Ga0439464_0092955 3300042439 Bacteria 911
92 Ga0451577_0041781 3300042876 Bacteria 4115
93 Ga0466969_0052137 3300044656 Bacteria 2011
94 Ga0466961_0051470 3300044693 Bacteria 2630
95 Ga0466963_0105125 3300044694 Bacteria 1935
96 Ga0466963_0203966 3300044694 Bacteria 1383
97 Ga0453684_0106481 3300044712 Bacteria 3417
98 Ga0466971_0034591 3300044719 Bacteria 2264
99 Ga0466971_0111903 3300044719 Bacteria 1260
100 Ga0466968_0271004 3300044735 Bacteria 810
101 Ga0466968_0693452 3300044735 Unclassified 519
102 Ga0466957_0304166 3300044842 Bacteria 1072
103 Ga0466957_0489616 3300044842 Bacteria 851
104 Ga0466957_0807842 3300044842 Unclassified 667
105 Ga0466959_0069894 3300045049 Unclassified 2544
106 Ga0466959_0071023 3300045049 Bacteria 2522
107 Ga0466959_0172773 3300045049 Bacteria 1515
108 Ga0466959_0322904 3300045049 Bacteria 1055
109 Ga0466959_0424738 3300045049 Bacteria 902
110 Ga0466959_0816311 3300045049 Unclassified 623
111 Ga0451576_0029644 3300045051 Bacteria 5854
112 Ga0466958_0009122 3300045836 Bacteria 5515
113 Ga0466958_0011768 3300045836 Bacteria 4940
114 Ga0466958_0061581 3300045836 Bacteria 2286
115 Ga0466958_0083207 3300045836 Bacteria 1972
116 Ga0466958_0199560 3300045836 Bacteria 1273
117 Ga0466958_0848297 3300045836 Unclassified 596
118 Ga0466967_0337791 3300045976 Bacteria 1456
119 Ga0466967_0369156 3300045976 Unclassified 1392
120 Ga0466967_0413542 3300045976 Unclassified 1314
121 Ga0466967_0466163 3300045976 Unclassified 1236
122 Ga0466967_0688378 3300045976 Unclassified 1012
123 Ga0466967_0691022 3300045976 Bacteria 1010
124 Ga0466967_0905525 3300045976 Bacteria 877
125 Ga0466967_1673637 3300045976 Bacteria 634
126 Ga0466967_2099034 3300045976 Unclassified 561
127 Ga0495659_0391608 3300046664 Bacteria 599
128 Ga0496101_0394965 3300048904 Bacteria 1089
129 Ga0496108_0863347 3300048911 Unclassified 778
130 Ga0496110_0389190 3300048913 Bacteria 1271
131 Ga0501037_0150308 3300049573 Bacteria 1665
132 Ga0501039_0433005 3300049575 Bacteria 1033
133 Ga0501067_0648916 3300049583 Bacteria 592
134 Ga0501068_0235462 3300049584 Bacteria 1165
135 Ga0501073_0146548 3300049589 Bacteria 1636
136 Ga0501044_0006635 3300049823 Bacteria 12760
137 Ga0501044_0061570 3300049823 Bacteria 3839
138 nmdc:mga00v17_232700_c1 3300050491 Bacteria 1194
139 nmdc:mga0yw44_85029_c1 3300050492 Bacteria 1990
140 nmdc:mga05p37_302769_c1 3300050507 Bacteria 1899
141 nmdc:mga09592_879361_c1 3300050508 Bacteria 754
142 nmdc:mga06r32_1103570_c1 3300050510 Bacteria 742
143 nmdc:mga06r32_1939395_c1 3300050510 Unclassified 523
144 nmdc:mga06r32_636560_c1 3300050510 Bacteria 1035
145 nmdc:mga08y16_221567_c1 3300050511 Bacteria 1958
146 Ga0587073_0159240 3300059492 Bacteria 646
147 Ga0466962_0002447 3300061719 Bacteria 8806
148 Ga0213876_10062940
149 JGI24751J29686_10004271
150 rootH2_10255297
151 Ga0070683_100043091
152 Ga0070670_100552947
153 Ga0070670_100641821
154 Ga0068869_100770672
155 Ga0070682_100484019
156 Ga0070661_100079283
157 Ga0070675_100249823
158 Ga0070674_100342710
159 Ga0070709_10263027
160 Ga0070714_100448478
161 Ga0070705_100041569
162 Ga0070708_100438574
163 Ga0070678_100031799
164 Ga0070685_10036707
165 Ga0070699_100660441
166 Ga0070684_100322629
167 Ga0070696_100139375
168 Ga0068855_100030322
169 Ga0070664_100001112
170 Ga0070664_101525910
171 Ga0068857_100260646
172 Ga0068866_10284242
173 Ga0068870_10030856
174 Ga0081539_10061287
175 Ga0070717_10259637
176 Ga0075365_10004052
177 Ga0075364_10116675
178 Ga0075367_10497039
179 Ga0097621_100568649
180 Ga0068871_100311882
181 Ga0075428_100127837
182 Ga0075428_101606400
183 Ga0075430_100300093
184 Ga0075430_101130411
185 Ga0075431_101533334
186 Ga0075433_10062156
187 Ga0075434_100330913
188 Ga0105240_10096693
189 Ga0111539_10107782
190 Ga0111539_11367008
191 Ga0105245_10066435
192 Ga0105245_10084962
193 Ga0114129_10034725
194 Ga0105243_10052820
195 Ga0105242_10026646
196 Ga0105239_10000046
197 Ga0105246_10036399
198 Ga0157378_10706838
199 Ga0163163_13113095
200 Ga0157380_10094184
201 Ga0182008_10668150
202 Ga0157379_10742607
203 Ga0157376_10145166
204 Ga0213874_10116970
205 Ga0207643_10080200
206 Ga0207695_10844148
207 Ga0207649_10065033
208 Ga0207650_10011585
209 Ga0207650_11606280
210 Ga0207659_10209931
211 Ga0207687_10027424
212 Ga0207687_10109091
213 Ga0207664_10397697
214 Ga0207686_10050011
215 Ga0207709_10073579
216 Ga0207691_10405736
217 Ga0207689_10009891
218 Ga0207661_10030086
219 Ga0207679_10000437
220 Ga0207667_10099769
221 Ga0207674_10102854
222 Ga0207674_10116142
223 Ga0207683_10013085
224 Ga0207428_10807386
225 Ga0373926_0183820
226 Ga0373932_0000454
227 Ga0373927_0518694
228 Ga0373947_0084059
229 Ga0373925_0121506
230 Ga0436364_0225304
231 Ga0436365_0693811
232 Ga0436365_1597781
233 Ga0436365_1880636
234 Ga0436363_0793132
235 Ga0436363_0802067
236 Ga0436363_0828554
237 Ga0436363_1031446
238 Ga0439464_0092955
239 Ga0451577_0041781
240 Ga0466969_0052137
241 Ga0466961_0051470
242 Ga0466963_0105125
243 Ga0466963_0203966
244 Ga0453684_0106481
245 Ga0466971_0034591
246 Ga0466971_0111903
247 Ga0466968_0271004
248 Ga0466968_0693452
249 Ga0466957_0304166
250 Ga0466957_0489616
251 Ga0466957_0807842
252 Ga0466959_0069894
253 Ga0466959_0071023
254 Ga0466959_0172773
255 Ga0466959_0322904
256 Ga0466959_0424738
257 Ga0466959_0816311
258 Ga0451576_0029644
259 Ga0466958_0009122
260 Ga0466958_0011768
261 Ga0466958_0061581
262 Ga0466958_0083207
263 Ga0466958_0199560
264 Ga0466958_0848297
265 Ga0466967_0337791
266 Ga0466967_0369156
267 Ga0466967_0413542
268 Ga0466967_0466163
269 Ga0466967_0688378
270 Ga0466967_0691022
271 Ga0466967_0905525
272 Ga0466967_1673637
273 Ga0466967_2099034
274 Ga0495659_0391608
275 Ga0496101_0394965
276 Ga0496108_0863347
277 Ga0496110_0389190
278 Ga0501037_0150308
279 Ga0501039_0433005
280 Ga0501067_0648916
281 Ga0501068_0235462
282 Ga0501073_0146548
283 Ga0501044_0006635
284 Ga0501044_0061570
285 nmdc:mga00v17_232700_c1
286 nmdc:mga0yw44_85029_c1
287 nmdc:mga05p37_302769_c1
288 nmdc:mga09592_879361_c1
289 nmdc:mga06r32_1103570_c1
290 nmdc:mga06r32_1939395_c1
291 nmdc:mga06r32_636560_c1
292 nmdc:mga08y16_221567_c1
293 Ga0587073_0159240
294 Ga0466962_0002447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01980

TrmO

tRNA-methyltransferase O

40

153

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nv4-assembly1.cif.gz_B crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 0.8684 5 131
3okx-assembly1.cif.gz_B crystal structure of yaeb-like protein from rhodopseudomonas palustris 0.8441 1 130
3okx-assembly1.cif.gz_A crystal structure of yaeb-like protein from rhodopseudomonas palustris 0.8415 1 130
2nv4-assembly1.cif.gz_B crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 0.8203 5 131
3okx-assembly1.cif.gz_B crystal structure of yaeb-like protein from rhodopseudomonas palustris 0.8148 1 130
ID Description Score Start End Superfamily
2nv4B00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8636 6 131 2.40.30.70
3okxB00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8441 1 130 2.40.30.70
af_A1Z759_99_248_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8244 6 131 2.40.30.70
3okxB00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8148 1 130 2.40.30.70
af_Q9BU70_29_181_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8147 6 131 2.40.30.70
ID Description Score Start End GO Terms
AF-A0A372JAW0-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.9004 5 132 GO:0008168
GO:0032259
AF-A0A1X7C6R8-F1-model_v4 tRNA-Thr(GGU) m(6)t(6)A37 methyltransferase TsaA 0.9002 5 130 GO:0008168
GO:0032259
AF-A0A4T2AM35-F1-model_v4 deleted 0.8995 5 132
AF-A0A846QPQ6-F1-model_v4 L-fuculose-phosphate aldolase (EC 4.1.2.17) 0.8983 5 130 GO:0005829
GO:0016832
GO:0019323
AF-A0A1T4WTP3-F1-model_v4 tRNA-Thr(GGU) m(6)t(6)A37 methyltransferase TsaA 0.8975 5 131 GO:0008168
GO:0032259

Map