F200103

General Info

Members Datasets Scaffolds Average Seq Length
147 125 129 97

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_101367572|Ga0075434_1013675722
Length 104
Sequence LGEARSVKLRYTVPALADLSSILDYIAAHSPQGAKRVQARIQTVISLLLTHPHIGVRTDDPTIRRLTTTPYPHLVFYEVSETEIIIHAIRHGARNPSGMPGSAQ

Samples

Sample ID Description Type Environment
1 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
2 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
3 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
4 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
5 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
62 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
64 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
65 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
66 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
67 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
68 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
71 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
72 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
73 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
74 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
75 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
76 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
77 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
78 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
79 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
83 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
84 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
85 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
86 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
87 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
88 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
89 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
90 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
91 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
92 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
93 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
94 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
95 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
96 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
97 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
98 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
99 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
100 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
101 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
102 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
103 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
104 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
105 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
106 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
107 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
108 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
109 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
110 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
111 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
112 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
113 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
114 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
115 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
116 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
117 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
118 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
119 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
120 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
121 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
122 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
123 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
124 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
125 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.07
Metatranscriptomes 0
Isolates 12.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.69
Nodule 11.56
Rhizoplane 0.68
Rhizosphere 61.9
Stem 0
Stem Tuber 0
Unclassified 8.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10175479 3300003203 Unclassified 625
2 rootH1_10109485 3300003316 Bacteria 2172
3 rootH1_10109485 3300003323 Bacteria 2466
4 Ga0070680_101374174 3300005336 Bacteria 611
5 Ga0070682_100086690 3300005337 Bacteria 2039
6 Ga0070660_101395969 3300005339 Bacteria 595
7 Ga0070689_100334110 3300005340 Unclassified 1268
8 Ga0070668_100117338 3300005347 Bacteria 2123
9 Ga0070667_100427140 3300005367 Bacteria 1209
10 Ga0070709_10151812 3300005434 Bacteria 1602
11 Ga0070709_10611917 3300005434 Unclassified 840
12 Ga0070709_11361140 3300005434 Unclassified 574
13 Ga0070714_100026092 3300005435 Bacteria 4827
14 Ga0070710_10341522 3300005437 Bacteria 989
15 Ga0070708_101407536 3300005445 Bacteria 650
16 Ga0070681_10157973 3300005458 Bacteria 2191
17 Ga0068867_101651586 3300005459 Unclassified 600
18 Ga0070685_10477636 3300005466 Bacteria 878
19 Ga0070684_101353535 3300005535 Bacteria 670
20 Ga0070697_101269019 3300005536 Unclassified 657
21 Ga0068861_100104420 3300005719 Bacteria 2260
22 Ga0068863_101060697 3300005841 Unclassified 814
23 Ga0068860_100986391 3300005843 Bacteria 860
24 Ga0068860_101701570 3300005843 Bacteria 653
25 Ga0068862_100282966 3300005844 Bacteria 1520
26 Ga0081539_10053449 3300005985 Bacteria 2261
27 Ga0070717_10256278 3300006028 Unclassified 1547
28 Ga0075364_10619832 3300006051 Bacteria 739
29 Ga0075367_10689268 3300006178 Bacteria 650
30 Ga0075431_100000512 3300006847 Bacteria 32460
31 Ga0075434_101367572 3300006871 Bacteria 718
32 Ga0075434_101708264 3300006871 Bacteria 637
33 Ga0075429_100011384 3300006880 Bacteria 7704
34 Ga0068865_100349669 3300006881 Bacteria 1197
35 Ga0099794_10190419 3300007265 Bacteria 1049
36 Ga0099795_10139292 3300007788 Bacteria 986
37 Ga0114129_11590519 3300009147 Bacteria 800
38 Ga0114129_11855606 3300009147 Bacteria 732
39 Ga0105237_10335176 3300009545 Bacteria 1517
40 Ga0105237_12499336 3300009545 Bacteria 527
41 Ga0105238_10489703 3300009551 Bacteria 1229
42 Ga0105249_10652389 3300009553 Bacteria 1110
43 Ga0099796_10012698 3300010159 Bacteria 2386
44 Ga0105239_10319692 3300010375 Bacteria 1750
45 Ga0157369_12437227 3300013105 Bacteria 530
46 Ga0213873_10000299 3300021358 Bacteria 8594
47 Ga0213876_10003743 3300021384 Bacteria 8626
48 Ga0207685_10590208 3300025905 Bacteria 595
49 Ga0207699_10272982 3300025906 Bacteria 1172
50 Ga0207707_10665919 3300025912 Bacteria 876
51 Ga0207695_10104012 3300025913 Bacteria 2830
52 Ga0207671_10266914 3300025914 Bacteria 1348
53 Ga0207671_11327881 3300025914 Bacteria 559
54 Ga0207693_10638276 3300025915 Unclassified 828
55 Ga0207657_11159585 3300025919 Bacteria 589
56 Ga0207694_10422087 3300025924 Bacteria 1111
57 Ga0207664_10100567 3300025929 Bacteria 2388
58 Ga0207664_10645187 3300025929 Bacteria 951
59 Ga0207668_10336601 3300025972 Bacteria 1257
60 Ga0207641_11523325 3300026088 Bacteria 670
61 Ga0207675_101079499 3300026118 Bacteria 822
62 Ga0268265_10065379 3300028380 Bacteria 2806
63 Ga0265338_10088857 3300028800 Bacteria 2562
64 Ga0265338_10506678 3300028800 Bacteria 849
65 Ga0265327_10004761 3300031251 Bacteria 11814
66 Ga0307508_10049567 3300031616 Bacteria 3740
67 Ga0373925_1454336 3300037068 Unclassified 561
68 Ga0436364_0068350 3300037853 Bacteria 1771
69 Ga0436365_0269941 3300039437 Bacteria 8609
70 Ga0436365_1711076 3300039437 Unclassified 826
71 Ga0436365_1831657 3300039437 Bacteria 1359
72 Ga0436360_0070086 3300039438 Unclassified 851
73 Ga0436360_0137859 3300039438 Bacteria 2052
74 Ga0436360_0632222 3300039438 Bacteria 1607
75 Ga0436360_0658377 3300039438 Bacteria 1025
76 Ga0436360_0778279 3300039438 Bacteria 720
77 Ga0436363_0012097 3300039450 Bacteria 2871
78 Ga0436362_0433542 3300039453 Bacteria 2208
79 Ga0436362_0917334 3300039453 Bacteria 11107
80 Ga0466965_0010547 3300044683 Bacteria 4316
81 Ga0466960_0166053 3300044901 Bacteria 1188
82 Ga0466967_0494262 3300045976 Bacteria 1200
83 Ga0495584_0473048 3300046491 Bacteria 638
84 Ga0495648_0104210 3300046524 Bacteria 1558
85 Ga0495599_0103311 3300046678 Bacteria 1776
86 Ga0495673_0061732 3300047469 Bacteria 1603
87 Ga0496115_0872975 3300048918 Bacteria 695
88 Ga0496121_0037736 3300048924 Bacteria 4286
89 Ga0496124_0130433 3300048927 Bacteria 1998
90 Ga0496126_0003357 3300048929 Bacteria 20298
91 Ga0495682_0021191 3300049460 Bacteria 2437
92 Ga0501034_0311825 3300049571 Bacteria 1507
93 Ga0501043_0615047 3300049579 Unclassified 801
94 Ga0501073_0347465 3300049589 Bacteria 1024
95 Ga0501073_0423512 3300049589 Bacteria 920
96 Ga0501080_0221612 3300049742 Bacteria 1731
97 Ga0501083_0058540 3300049744 Bacteria 2578
98 nmdc:mga00v17_442210_c1 3300050491 Bacteria 844
99 nmdc:mga07m45_645448_c1 3300050496 Unclassified 610
100 nmdc:mga05p37_1060863_c1 3300050507 Bacteria 853
101 nmdc:mga09592_9949_c1 3300050508 Bacteria 7737
102 nmdc:mga0qj67_1186946_c1 3300050509 Unclassified 594
103 nmdc:mga06r32_863_c1 3300050510 Bacteria 26925
104 nmdc:mga0n895_1173040_c1 3300050512 Bacteria 743
105 Ga0495619_0862438 3300053085 Bacteria 610
106 Ga0500583_0052315 3300053092 Bacteria 1900
107 Ga0500651_0483295 3300053093 Bacteria 685
108 Ga0500648_084022 3300053097 Bacteria 1788
109 Ga0500555_006365 3300053103 Bacteria 3353
110 Ga0500562_021561 3300053108 Bacteria 1677
111 Ga0500595_008876 3300053119 Bacteria 4084
112 Ga0500595_045102 3300053119 Bacteria 1394
113 Ga0500614_012454 3300053123 Bacteria 1856
114 Ga0500642_0005751 3300053130 Bacteria 4030
115 Ga0500642_0144156 3300053130 Bacteria 1118
116 Ga0500652_152763 3300053131 Bacteria 957
117 Ga0500559_0012783 3300053136 Bacteria 3563
118 Ga0500568_0005970 3300053139 Bacteria 6190
119 Ga0500573_0002809 3300053140 Bacteria 8829
120 Ga0500573_0039399 3300053140 Bacteria 2729
121 Ga0500589_262376 3300053147 Bacteria 629
122 Ga0500590_057262 3300053148 Bacteria 1967
123 Ga0500590_356439 3300053148 Unclassified 520
124 Ga0500638_205181 3300053162 Bacteria 830
125 Ga0500636_0080119 3300053177 Bacteria 1882
126 Ga0500636_0183425 3300053177 Bacteria 1121
127 Ga0500637_0334519 3300053178 Bacteria 812
128 Ga0501082_0000016 3300060353 Bacteria 115081
129 Ga0530510_0944594 3300061734 Bacteria 659

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2842922631 2842924879 84
2 3300039453 Ga0436362_0433542 Ga0436362_0433542_1022_1315 87
3 3300050496 nmdc:mga07m45_645448_c1 nmdc:mga07m45_645448_c1_76_342 88
4 3300028800 Ga0265338_10506678 Ga0265338_105066782 91
5 iso_pu_bacteria 2513237102 2513701838 93
6 iso_pu_bacteria 2841957949 2841961585 93
7 iso_pu_bacteria 2935777560 2935782524 93
8 iso_pu_bacteria 8016522445 8016524540 93
9 iso_pu_bacteria 8016530956 8016538102 93
10 iso_pu_bacteria 8016539877 8016542379 93
11 iso_pu_bacteria 8016548790 8016550898 93
12 iso_pu_bacteria 8016557553 8016559312 93
13 iso_pu_bacteria 8016566248 8016567763 93
14 iso_pu_bacteria 8016575299 8016580455 93
15 iso_pu_bacteria 8016595262 8016597257 93
16 iso_pu_bacteria 8016603502 8016605005 93
17 iso_pu_bacteria 8016613128 8016620006 93
18 iso_pu_bacteria 8016622563 8016624226 93
19 iso_pu_bacteria 8019530166 8019537770 93
20 iso_pu_bacteria 8019538911 8019539399 93
21 iso_pu_bacteria 8019547302 8019551246 93
22 3300005340 Ga0070689_100334110 Ga0070689_1003341102 95
23 3300005459 Ga0068867_101651586 Ga0068867_1016515861 95
24 3300005466 Ga0070685_10477636 Ga0070685_104776361 95
25 3300005841 Ga0068863_101060697 Ga0068863_1010606973 95
26 3300005843 Ga0068860_100986391 Ga0068860_1009863912 95
27 3300006881 Ga0068865_100349669 Ga0068865_1003496692 95
28 3300047469 Ga0495673_0061732 Ga0495673_0061732_985_1272 95
29 3300028800 Ga0265338_10088857 Ga0265338_100888573 96
30 3300003203 JGI25406J46586_10175479 JGI25406J46586_101754791 97
31 3300003323 rootH1_10109485 rootH1_101094854 97
32 3300005336 Ga0070680_101374174 Ga0070680_1013741741 97
33 3300005337 Ga0070682_100086690 Ga0070682_1000866906 97
34 3300005339 Ga0070660_101395969 Ga0070660_1013959692 97
35 3300005347 Ga0070668_100117338 Ga0070668_1001173383 97
36 3300005367 Ga0070667_100427140 Ga0070667_1004271401 97
37 3300005434 Ga0070709_10151812 Ga0070709_101518121 97
38 3300005434 Ga0070709_10611917 Ga0070709_106119172 97
39 3300005434 Ga0070709_11361140 Ga0070709_113611402 97
40 3300005435 Ga0070714_100026092 Ga0070714_1000260925 97
41 3300005437 Ga0070710_10341522 Ga0070710_103415221 97
42 3300005445 Ga0070708_101407536 Ga0070708_1014075362 97
43 3300005458 Ga0070681_10157973 Ga0070681_101579732 97
44 3300005535 Ga0070684_101353535 Ga0070684_1013535352 97
45 3300005536 Ga0070697_101269019 Ga0070697_1012690192 97
46 3300005719 Ga0068861_100104420 Ga0068861_1001044201 97
47 3300005843 Ga0068860_101701570 Ga0068860_1017015702 97
48 3300005844 Ga0068862_100282966 Ga0068862_1002829663 97
49 3300005985 Ga0081539_10053449 Ga0081539_100534491 97
50 3300006028 Ga0070717_10256278 Ga0070717_102562784 97
51 3300006051 Ga0075364_10619832 Ga0075364_106198322 97
52 3300006178 Ga0075367_10689268 Ga0075367_106892682 97
53 3300006847 Ga0075431_100000512 Ga0075431_10000051223 97
54 3300006871 Ga0075434_101367572 Ga0075434_1013675722 97
55 3300006871 Ga0075434_101708264 Ga0075434_1017082642 97
56 3300006880 Ga0075429_100011384 Ga0075429_1000113847 97
57 3300007265 Ga0099794_10190419 Ga0099794_101904192 97
58 3300007788 Ga0099795_10139292 Ga0099795_101392922 97
59 3300009147 Ga0114129_11590519 Ga0114129_115905191 97
60 3300009147 Ga0114129_11855606 Ga0114129_118556061 97
61 3300009545 Ga0105237_10335176 Ga0105237_103351762 97
62 3300009545 Ga0105237_12499336 Ga0105237_124993362 97
63 3300009551 Ga0105238_10489703 Ga0105238_104897032 97
64 3300009553 Ga0105249_10652389 Ga0105249_106523892 97
65 3300010159 Ga0099796_10012698 Ga0099796_100126982 97
66 3300010375 Ga0105239_10319692 Ga0105239_103196921 97
67 3300013105 Ga0157369_12437227 Ga0157369_124372272 97
68 3300021358 Ga0213873_10000299 Ga0213873_100002998 97
69 3300021384 Ga0213876_10003743 Ga0213876_100037436 97
70 3300025905 Ga0207685_10590208 Ga0207685_105902081 97
71 3300025906 Ga0207699_10272982 Ga0207699_102729823 97
72 3300025912 Ga0207707_10665919 Ga0207707_106659191 97
73 3300025913 Ga0207695_10104012 Ga0207695_101040124 97
74 3300025914 Ga0207671_10266914 Ga0207671_102669142 97
75 3300025914 Ga0207671_11327881 Ga0207671_113278811 97
76 3300025915 Ga0207693_10638276 Ga0207693_106382763 97
77 3300025919 Ga0207657_11159585 Ga0207657_111595851 97
78 3300025924 Ga0207694_10422087 Ga0207694_104220872 97
79 3300025929 Ga0207664_10100567 Ga0207664_101005672 97
80 3300025929 Ga0207664_10645187 Ga0207664_106451872 97
81 3300025972 Ga0207668_10336601 Ga0207668_103366011 97
82 3300026088 Ga0207641_11523325 Ga0207641_115233252 97
83 3300026118 Ga0207675_101079499 Ga0207675_1010794991 97
84 3300028380 Ga0268265_10065379 Ga0268265_100653792 97
85 3300031251 Ga0265327_10004761 Ga0265327_100047615 97
86 3300031616 Ga0307508_10049567 Ga0307508_100495677 97
87 3300037068 Ga0373925_1454336 Ga0373925_1454336_213_506 97
88 3300037853 Ga0436364_0068350 Ga0436364_0068350_1117_1419 97
89 3300039437 Ga0436365_0269941 Ga0436365_0269941_1090_1383 97
90 3300039437 Ga0436365_1711076 Ga0436365_1711076_407_700 97
91 3300039437 Ga0436365_1831657 Ga0436365_1831657_396_692 97
92 3300039438 Ga0436360_0070086 Ga0436360_0070086_263_556 97
93 3300039438 Ga0436360_0137859 Ga0436360_0137859_1178_1471 97
94 3300039438 Ga0436360_0632222 Ga0436360_0632222_1148_1441 97
95 3300039438 Ga0436360_0658377 Ga0436360_0658377_525_818 97
96 3300039438 Ga0436360_0778279 Ga0436360_0778279_124_417 97
97 3300039450 Ga0436363_0012097 Ga0436363_0012097_2062_2355 97
98 3300039453 Ga0436362_0917334 Ga0436362_0917334_9769_10062 97
99 3300044683 Ga0466965_0010547 Ga0466965_0010547_2461_2763 97
100 3300044901 Ga0466960_0166053 Ga0466960_0166053_450_752 97
101 3300045976 Ga0466967_0494262 Ga0466967_0494262_232_525 97
102 3300046491 Ga0495584_0473048 Ga0495584_0473048_59_352 97
103 3300046524 Ga0495648_0104210 Ga0495648_0104210_15_317 97
104 3300046678 Ga0495599_0103311 Ga0495599_0103311_297_590 97
105 3300048918 Ga0496115_0872975 Ga0496115_0872975_146_439 97
106 3300048924 Ga0496121_0037736 Ga0496121_0037736_3629_3922 97
107 3300048927 Ga0496124_0130433 Ga0496124_0130433_347_640 97
108 3300048929 Ga0496126_0003357 Ga0496126_0003357_10807_11100 97
109 3300049460 Ga0495682_0021191 Ga0495682_0021191_361_654 97
110 3300049571 Ga0501034_0311825 Ga0501034_0311825_1129_1422 97
111 3300049579 Ga0501043_0615047 Ga0501043_0615047_114_407 97
112 3300049589 Ga0501073_0347465 Ga0501073_0347465_291_584 97
113 3300049589 Ga0501073_0423512 Ga0501073_0423512_275_568 97
114 3300049742 Ga0501080_0221612 Ga0501080_0221612_246_539 97
115 3300049744 Ga0501083_0058540 Ga0501083_0058540_1687_1980 97
116 3300050491 nmdc:mga00v17_442210_c1 nmdc:mga00v17_442210_c1_173_466 97
117 3300050507 nmdc:mga05p37_1060863_c1 nmdc:mga05p37_1060863_c1_45_338 97
118 3300050508 nmdc:mga09592_9949_c1 nmdc:mga09592_9949_c1_1236_1529 97
119 3300050509 nmdc:mga0qj67_1186946_c1 nmdc:mga0qj67_1186946_c1_208_507 97
120 3300050510 nmdc:mga06r32_863_c1 nmdc:mga06r32_863_c1_17035_17328 97
121 3300050512 nmdc:mga0n895_1173040_c1 nmdc:mga0n895_1173040_c1_235_531 97
122 3300053085 Ga0495619_0862438 Ga0495619_0862438_304_597 97
123 3300053092 Ga0500583_0052315 Ga0500583_0052315_551_853 97
124 3300053093 Ga0500651_0483295 Ga0500651_0483295_151_444 97
125 3300053097 Ga0500648_084022 Ga0500648_084022_1047_1340 97
126 3300053103 Ga0500555_006365 Ga0500555_006365_2295_2597 97
127 3300053108 Ga0500562_021561 Ga0500562_021561_23_319 97
128 3300053119 Ga0500595_008876 Ga0500595_008876_3543_3836 97
129 3300053119 Ga0500595_045102 Ga0500595_045102_162_455 97
130 3300053123 Ga0500614_012454 Ga0500614_012454_671_964 97
131 3300053130 Ga0500642_0005751 Ga0500642_0005751_3712_4014 97
132 3300053130 Ga0500642_0144156 Ga0500642_0144156_480_773 97
133 3300053131 Ga0500652_152763 Ga0500652_152763_177_479 97
134 3300053136 Ga0500559_0012783 Ga0500559_0012783_1442_1735 97
135 3300053139 Ga0500568_0005970 Ga0500568_0005970_1757_2059 97
136 3300053140 Ga0500573_0002809 Ga0500573_0002809_7550_7861 97
137 3300053140 Ga0500573_0039399 Ga0500573_0039399_1689_1982 97
138 3300053147 Ga0500589_262376 Ga0500589_262376_151_453 97
139 3300053148 Ga0500590_057262 Ga0500590_057262_619_912 97
140 3300053148 Ga0500590_356439 Ga0500590_356439_114_407 97
141 3300053162 Ga0500638_205181 Ga0500638_205181_463_756 97
142 3300053177 Ga0500636_0080119 Ga0500636_0080119_314_607 97
143 3300053177 Ga0500636_0183425 Ga0500636_0183425_190_483 97
144 3300053178 Ga0500637_0334519 Ga0500637_0334519_164_457 97
145 3300060353 Ga0501082_0000016 Ga0501082_0000016_50170_50463 97
146 3300061734 Ga0530510_0944594 Ga0530510_0944594_317_610 97
147 iso_pu_bacteria 2861691609 2861692294 97

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05016

ParE_toxin

ParE toxin of type II toxin-antitoxin system, parDE

9

96

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5czf-assembly2.cif.gz_C crystal structure of the paaa2-pare2 antitoxin-toxin complex 0.923 1 88
5cze-assembly1.cif.gz_J crystal structure of the paaa2-pare2 antitoxin-toxin complex 0.9186 5 88
7ycu-assembly1.cif.gz_C-2 heterotetramer of antitoxin prpa together with toxin prpt from pseudoalteromonas rubra 0.9142 3 89
3kxe-assembly1.cif.gz_B a conserved mode of protein recognition and binding in a pard-pare toxin-antitoxin complex 0.9029 1 89
5ceg-assembly1.cif.gz_B x-ray structure of toxin/anti-toxin complex from mesorhizobium opportunistum 0.8855 1 93
ID Description Score Start End Superfamily
af_P9WHG7_1_98_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9247 2 89 3.30.2310.20
5cw7F00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9199 1 88 3.30.2310.20
5cegD00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9162 1 89 3.30.2310.20
af_P9WHG5_4_92_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8765 2 90 3.30.2310.20
af_P9WHG5_4_92_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8676 2 90 3.30.2310.20
ID Description Score Start End GO Terms
AF-A0A327KW17-F1-model_v4 Plasmid stabilization protein 0.9944 1 88
AF-A0A068SRZ4-F1-model_v4 Putative stabilisation protein 0.9902 1 88
AF-A0A1F6ET74-F1-model_v4 Plasmid stabilization protein 0.9898 1 88
AF-W0DLR6-F1-model_v4 Toxin Y4kP 0.9886 1 88
AF-A0A2S5M8E9-F1-model_v4 Stabilization protein 0.9885 1 88

Feature Viewer

pLDDT pTM Quality
90.82 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map