F200024

General Info

Members Datasets Scaffolds Average Seq Length
147 123 294 257

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100259495|Ga0097621_1002594952
Length 284
Sequence MTMSTTNAHGVSGSQASSIGTVPTQLLFGIPIHPMTMSEAIEVCDQTIQNRKKLMIGVVNAAKIVNMRRMPILGQAVLQSDLVLADGMAIVWASRILRRPLPERVAGIDLFEQLLGVANRRGYSIYLLGATQVVMDRLVVRITAQYPNLHIAGSRNGYFKDDENEKIATQIRDAKPDMLFLGMTSPKKEVFLARWNTFMDVPVCHGVGGSFDVLSGQTKRAPESWQKLGLEWLYRVVQEPRRMWKRYLVTNTIFVGLLIRELFHRSPPLVLEAAPTTPNSAAAT

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
58 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
59 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
60 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
61 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
62 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
68 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
69 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
70 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
71 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
74 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
75 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
76 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
77 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
78 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
79 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
80 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
81 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
82 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
83 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
84 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
90 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
91 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
92 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
93 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
101 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
102 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
105 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
106 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
113 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
114 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
118 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
119 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
120 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
121 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
122 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
123 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 0
Isolates 1.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.44
Nodule 0
Rhizoplane 2.04
Rhizosphere 82.31
Stem 0
Stem Tuber 0
Unclassified 12.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_100259495 3300006237 Unclassified 1524
2 JGI25406J46586_10057686 3300003203 Unclassified 1269
3 Ga0070683_100176153 3300005329 Bacteria 2030
4 Ga0068869_100091363 3300005334 Bacteria 2290
5 Ga0070666_10149792 3300005335 Unclassified 1627
6 Ga0070675_100308702 3300005354 Unclassified 1395
7 Ga0070659_100330272 3300005366 Bacteria 1276
8 Ga0070703_10013330 3300005406 Unclassified 2334
9 Ga0070709_10182066 3300005434 Bacteria 1476
10 Ga0070705_100003673 3300005440 Bacteria 7516
11 Ga0068867_100248464 3300005459 Bacteria 1445
12 Ga0070685_10069352 3300005466 Bacteria 2085
13 Ga0070706_100072413 3300005467 Bacteria 3189
14 Ga0070707_100319004 3300005468 Bacteria 1510
15 Ga0070697_100121144 3300005536 Bacteria 2188
16 Ga0070672_100338839 3300005543 Bacteria 1280
17 Ga0070665_100013527 3300005548 Bacteria 8209
18 Ga0070665_100393267 3300005548 Bacteria 1394
19 Ga0070704_100027043 3300005549 Bacteria 3798
20 Ga0070704_100059755 3300005549 Bacteria 2721
21 Ga0068855_100013633 3300005563 Bacteria 9803
22 Ga0068864_100000053 3300005618 Bacteria 133049
23 Ga0068863_100154206 3300005841 Bacteria 2199
24 Ga0081538_10014178 3300005981 Bacteria 6261
25 Ga0081538_10014297 3300005981 Bacteria 6220
26 Ga0081539_10000161 3300005985 Bacteria 156560
27 Ga0075365_10088510 3300006038 Bacteria 2107
28 Ga0075363_100184439 3300006048 Unclassified 1188
29 Ga0075367_10119395 3300006178 Bacteria 1624
30 Ga0097621_100007531 3300006237 Bacteria 7795
31 Ga0068871_100013409 3300006358 Bacteria 6083
32 Ga0075428_100103930 3300006844 Bacteria 3098
33 Ga0075433_10016378 3300006852 Bacteria 6108
34 Ga0068865_100048696 3300006881 Bacteria 2917
35 Ga0105240_10024482 3300009093 Bacteria 7954
36 Ga0111539_10021111 3300009094 Bacteria 8019
37 Ga0111539_10033554 3300009094 Bacteria 6231
38 Ga0111539_10121526 3300009094 Bacteria 3060
39 Ga0105245_10025144 3300009098 Bacteria 5236
40 Ga0114129_10016766 3300009147 Bacteria 10429
41 Ga0105238_10290627 3300009551 Bacteria 1617
42 Ga0157378_10252220 3300013297 Bacteria 1690
43 Ga0157378_10438121 3300013297 Bacteria 1295
44 Ga0163162_10054634 3300013306 Unclassified 4018
45 Ga0163163_10305486 3300014325 Unclassified 1643
46 Ga0163163_10623927 3300014325 Bacteria 1141
47 Ga0157376_10008949 3300014969 Bacteria 7251
48 Ga0207680_10267824 3300025903 Bacteria 1184
49 Ga0207645_10088840 3300025907 Unclassified 1987
50 Ga0207695_10021192 3300025913 Bacteria 7422
51 Ga0207671_10018978 3300025914 Bacteria 5267
52 Ga0207646_10371281 3300025922 Unclassified 1292
53 Ga0207687_10019910 3300025927 Bacteria 4450
54 Ga0207686_10143356 3300025934 Bacteria 1654
55 Ga0207704_10029238 3300025938 Bacteria 3069
56 Ga0207691_10387228 3300025940 Bacteria 1193
57 Ga0207689_10147777 3300025942 Bacteria 1936
58 Ga0207667_10034505 3300025949 Bacteria 5432
59 Ga0207678_10303012 3300026067 Bacteria 1373
60 Ga0207708_10099694 3300026075 Bacteria 2247
61 Ga0207641_10242880 3300026088 Bacteria 1679
62 Ga0207648_10054339 3300026089 Unclassified 3498
63 Ga0207676_10000195 3300026095 Bacteria 52951
64 Ga0268266_10043295 3300028379 Unclassified 3847
65 Ga0265318_10130814 3300028577 Unclassified 923
66 Ga0307513_10044051 3300031456 Bacteria 4892
67 Ga0307514_10122043 3300031649 Bacteria 1815
68 Ga0316579_10000671 3300031691 Bacteria 11570
69 Ga0307405_10062026 3300031731 Bacteria 2366
70 Ga0307405_10416263 3300031731 Bacteria 1056
71 Ga0307407_10166792 3300031903 Bacteria 1446
72 Ga0307412_10412407 3300031911 Bacteria 1103
73 Ga0307409_100253446 3300031995 Bacteria 1610
74 Ga0307416_100019451 3300032002 Bacteria 4815
75 Ga0307416_100038081 3300032002 Bacteria 3707
76 Ga0307415_100167711 3300032126 Bacteria 1709
77 Ga0373951_0000135 3300035091 Bacteria 27809
78 Ga0373941_0011159 3300035115 Bacteria 2315
79 Ga0373955_0192540 3300035172 Bacteria 1213
80 Ga0373942_0000677 3300035207 Bacteria 9506
81 Ga0373962_0006436 3300035242 Bacteria 2845
82 Ga0395901_0173496 3300038443 Bacteria 2262
83 Ga0400484_03594 3300038725 Bacteria 12809
84 Ga0400484_10716 3300038725 Bacteria 3762
85 Ga0400484_26939 3300038725 Bacteria 43017
86 Ga0400490_05567 3300038726 Bacteria 5043
87 Ga0400490_49511 3300038726 Bacteria 14984
88 Ga0400491_28797 3300038727 Bacteria 1353
89 Ga0400485_18725 3300038735 Bacteria 3441
90 Ga0400488_30385 3300038741 Bacteria 3703
91 Ga0400488_50496 3300038741 Bacteria 20862
92 Ga0400486_23014 3300038742 Bacteria 2053
93 Ga0400483_148170 3300039062 Bacteria 31328
94 Ga0400487_03854 3300039110 Bacteria 143220
95 Ga0400487_21088 3300039110 Bacteria 3664
96 Ga0451800_0043660 3300041459 Bacteria 1076
97 Ga0451807_0971115 3300041486 Bacteria 1103
98 Ga0466969_0010005 3300044656 Bacteria 5030
99 Ga0466961_0036577 3300044693 Bacteria 3151
100 Ga0466967_0426943 3300045976 Bacteria 1293
101 Ga0495652_0146697 3300046529 Unclassified 1849
102 Ga0495586_0056610 3300046535 Unclassified 2127
103 Ga0495645_0008888 3300046543 Bacteria 7018
104 Ga0495624_0181518 3300046690 Bacteria 1282
105 Ga0495675_0014517 3300047444 Bacteria 4978
106 Ga0495626_0066257 3300048091 Bacteria 1633
107 Ga0496105_0419125 3300048908 Bacteria 1060
108 Ga0501031_0022816 3300049568 Bacteria 4081
109 Ga0501036_0082707 3300049572 Bacteria 2714
110 Ga0501038_0124702 3300049574 Bacteria 2121
111 Ga0501038_0152845 3300049574 Bacteria 1881
112 Ga0501039_0036152 3300049575 Bacteria 3811
113 Ga0501039_0164365 3300049575 Bacteria 1745
114 Ga0501040_0195350 3300049576 Bacteria 1436
115 Ga0501042_0351361 3300049578 Bacteria 1066
116 Ga0501043_0481741 3300049579 Bacteria 929
117 Ga0501070_0033762 3300049586 Bacteria 4282
118 Ga0501071_0162924 3300049587 Bacteria 1667
119 Ga0501072_0024412 3300049588 Bacteria 4703
120 Ga0501072_0049783 3300049588 Bacteria 3298
121 Ga0501074_0070758 3300049590 Bacteria 2508
122 Ga0501075_0564104 3300049591 Unclassified 869
123 Ga0501076_0100045 3300049592 Bacteria 2336
124 Ga0501077_0168636 3300049593 Bacteria 1391
125 Ga0501079_0071122 3300049741 Bacteria 2687
126 Ga0501079_0126763 3300049741 Bacteria 1986
127 Ga0501080_0377346 3300049742 Bacteria 1278
128 Ga0501081_0162364 3300049743 Bacteria 1610
129 Ga0501081_0223585 3300049743 Bacteria 1369
130 Ga0501035_0404045 3300049822 Bacteria 1136
131 Ga0501044_0080363 3300049823 Unclassified 3303
132 nmdc:mga0yw44_24429_c1 3300050492 Bacteria 3419
133 nmdc:mga0k408_163654_c1 3300050493 Unclassified 1325
134 nmdc:mga06z11_117682_c1 3300050494 Bacteria 1479
135 nmdc:mga05p37_141356_c1 3300050507 Bacteria 2949
136 nmdc:mga05p37_6092_c1 3300050507 Bacteria 14201
137 nmdc:mga08y16_141581_c1 3300050511 Bacteria 2500
138 nmdc:mga08y16_36048_c1 3300050511 Bacteria 5194
139 Ga0500560_060183 3300053107 Bacteria 1236
140 Ga0500573_0102581 3300053140 Bacteria 1608
141 Ga0501084_0023309 3300054114 Bacteria 5168
142 Ga0501082_0045103 3300060353 Bacteria 3802
143 Ga0501082_0111833 3300060353 Bacteria 2364
144 Ga0530510_0057838 3300061734 Bacteria 2803
145 Ga0530510_0079103 3300061734 Bacteria 2391
146 2954008435 2954002825 Bacteria 9173742
147 3006492808 3006486233 Bacteria 8157040
148 Ga0097621_100259495
149 JGI25406J46586_10057686
150 Ga0070683_100176153
151 Ga0068869_100091363
152 Ga0070666_10149792
153 Ga0070675_100308702
154 Ga0070659_100330272
155 Ga0070703_10013330
156 Ga0070709_10182066
157 Ga0070705_100003673
158 Ga0068867_100248464
159 Ga0070685_10069352
160 Ga0070706_100072413
161 Ga0070707_100319004
162 Ga0070697_100121144
163 Ga0070672_100338839
164 Ga0070665_100013527
165 Ga0070665_100393267
166 Ga0070704_100027043
167 Ga0070704_100059755
168 Ga0068855_100013633
169 Ga0068864_100000053
170 Ga0068863_100154206
171 Ga0081538_10014178
172 Ga0081538_10014297
173 Ga0081539_10000161
174 Ga0075365_10088510
175 Ga0075363_100184439
176 Ga0075367_10119395
177 Ga0097621_100007531
178 Ga0068871_100013409
179 Ga0075428_100103930
180 Ga0075433_10016378
181 Ga0068865_100048696
182 Ga0105240_10024482
183 Ga0111539_10021111
184 Ga0111539_10033554
185 Ga0111539_10121526
186 Ga0105245_10025144
187 Ga0114129_10016766
188 Ga0105238_10290627
189 Ga0157378_10252220
190 Ga0157378_10438121
191 Ga0163162_10054634
192 Ga0163163_10305486
193 Ga0163163_10623927
194 Ga0157376_10008949
195 Ga0207680_10267824
196 Ga0207645_10088840
197 Ga0207695_10021192
198 Ga0207671_10018978
199 Ga0207646_10371281
200 Ga0207687_10019910
201 Ga0207686_10143356
202 Ga0207704_10029238
203 Ga0207691_10387228
204 Ga0207689_10147777
205 Ga0207667_10034505
206 Ga0207678_10303012
207 Ga0207708_10099694
208 Ga0207641_10242880
209 Ga0207648_10054339
210 Ga0207676_10000195
211 Ga0268266_10043295
212 Ga0265318_10130814
213 Ga0307513_10044051
214 Ga0307514_10122043
215 Ga0316579_10000671
216 Ga0307405_10062026
217 Ga0307405_10416263
218 Ga0307407_10166792
219 Ga0307412_10412407
220 Ga0307409_100253446
221 Ga0307416_100019451
222 Ga0307416_100038081
223 Ga0307415_100167711
224 Ga0373951_0000135
225 Ga0373941_0011159
226 Ga0373955_0192540
227 Ga0373942_0000677
228 Ga0373962_0006436
229 Ga0395901_0173496
230 Ga0400484_03594
231 Ga0400484_10716
232 Ga0400484_26939
233 Ga0400490_05567
234 Ga0400490_49511
235 Ga0400491_28797
236 Ga0400485_18725
237 Ga0400488_30385
238 Ga0400488_50496
239 Ga0400486_23014
240 Ga0400483_148170
241 Ga0400487_03854
242 Ga0400487_21088
243 Ga0451800_0043660
244 Ga0451807_0971115
245 Ga0466969_0010005
246 Ga0466961_0036577
247 Ga0466967_0426943
248 Ga0495652_0146697
249 Ga0495586_0056610
250 Ga0495645_0008888
251 Ga0495624_0181518
252 Ga0495675_0014517
253 Ga0495626_0066257
254 Ga0496105_0419125
255 Ga0501031_0022816
256 Ga0501036_0082707
257 Ga0501038_0124702
258 Ga0501038_0152845
259 Ga0501039_0036152
260 Ga0501039_0164365
261 Ga0501040_0195350
262 Ga0501042_0351361
263 Ga0501043_0481741
264 Ga0501070_0033762
265 Ga0501071_0162924
266 Ga0501072_0024412
267 Ga0501072_0049783
268 Ga0501074_0070758
269 Ga0501075_0564104
270 Ga0501076_0100045
271 Ga0501077_0168636
272 Ga0501079_0071122
273 Ga0501079_0126763
274 Ga0501080_0377346
275 Ga0501081_0162364
276 Ga0501081_0223585
277 Ga0501035_0404045
278 Ga0501044_0080363
279 nmdc:mga0yw44_24429_c1
280 nmdc:mga0k408_163654_c1
281 nmdc:mga06z11_117682_c1
282 nmdc:mga05p37_141356_c1
283 nmdc:mga05p37_6092_c1
284 nmdc:mga08y16_141581_c1
285 nmdc:mga08y16_36048_c1
286 Ga0500560_060183
287 Ga0500573_0102581
288 Ga0501084_0023309
289 Ga0501082_0045103
290 Ga0501082_0111833
291 Ga0530510_0057838
292 Ga0530510_0079103
293 2954008435
294 3006492808

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03808

Glyco_tran_WecG

Glycosyl transferase WecG/TagA/CpsF family

80

247

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wfg-assembly2.cif.gz_E crystal structure of the tara wall teichoic acid glycosyltransferase bound to udp 0.9519 10 202
5wfg-assembly2.cif.gz_D crystal structure of the tara wall teichoic acid glycosyltransferase bound to udp 0.9513 11 202
5wfg-assembly1.cif.gz_B crystal structure of the tara wall teichoic acid glycosyltransferase bound to udp 0.9504 10 202
5wfg-assembly2.cif.gz_F crystal structure of the tara wall teichoic acid glycosyltransferase bound to udp 0.9477 11 202
5wb4-assembly1.cif.gz_E crystal structure of the tara wall teichoic acid glycosyltransferase 0.9462 10 200
ID Description Score Start End Superfamily
af_Q2G2L3_69_233_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9257 66 231 3.40.50.2300
af_Q2G2L3_69_233_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9151 66 231 3.40.50.2300
af_P27836_65_232_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9121 66 232 3.40.50.2300
af_P27836_65_232_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9019 66 232 3.40.50.2300
af_O35199_188_301_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7338 98 192 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7C3D156-F1-model_v4 Glycosyltransferase 0.991 21 249 GO:0009058
GO:0016758
AF-A0A429ALZ9-F1-model_v4 Glycosyltransferase 0.9883 8 249 GO:0009058
GO:0016758
AF-W4L6M4-F1-model_v4 UDP-N-acetyl-D-mannosamine transferase 0.9865 10 253 GO:0009058
GO:0016758
AF-A0A3N5ZLC7-F1-model_v4 WecB/TagA/CpsF family glycosyltransferase 0.9862 9 208 GO:0009058
GO:0016758
AF-A0A4U6C9L7-F1-model_v4 WecB/TagA/CpsF family glycosyltransferase 0.9856 8 250 GO:0009058
GO:0016758

Map