F200001

General Info

Members Datasets Scaffolds Average Seq Length
147 117 294 157

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_101510787|Ga0070716_1015107871
Length 165
Sequence MTEEPQPQWIEEGDAAPDFTLPADDGSQVTLSALRGRPVVLYFYPKDDTPGCTKEACAFRDRSAELAARGAALFGVSPDDVASHGRFRDKFRLNFPLLADAGHRVAERYGAWREKNMYGKKSMGIQRSTFLIDPDGRVRKVWKRVSVEGHDEEVLAALAALSAQR

Samples

Sample ID Description Type Environment
1 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
71 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
75 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
76 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
77 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
78 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
79 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
80 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
81 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
82 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
87 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
88 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
89 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
90 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
97 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
98 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
99 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
100 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
101 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
102 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
103 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
104 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
105 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
106 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
107 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
108 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
109 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
110 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
111 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
112 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
113 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
114 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
115 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
116 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
117 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.72
Rhizosphere 95.24
Stem 0
Stem Tuber 0
Unclassified 2.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070716_101510787 3300006173 Bacteria 549
2 Ga0065707_10094706 3300005295 Bacteria 3461
3 Ga0070676_10015291 3300005328 Bacteria 4233
4 Ga0070690_100188203 3300005330 Bacteria 1430
5 Ga0070666_10067272 3300005335 Bacteria 2433
6 Ga0070682_100696838 3300005337 Bacteria 814
7 Ga0068868_101183952 3300005338 Bacteria 706
8 Ga0070687_100153516 3300005343 Bacteria 1354
9 Ga0070668_100254500 3300005347 Bacteria 1459
10 Ga0070669_100000011 3300005353 Bacteria 216544
11 Ga0070674_100671002 3300005356 Bacteria 883
12 Ga0070673_100279082 3300005364 Bacteria 1465
13 Ga0070667_100026321 3300005367 Bacteria 4838
14 Ga0070703_10323358 3300005406 Unclassified 650
15 Ga0070710_10051144 3300005437 Bacteria 2319
16 Ga0070701_10959871 3300005438 Bacteria 594
17 Ga0070694_100413473 3300005444 Bacteria 1058
18 Ga0070706_100053070 3300005467 Bacteria 3741
19 Ga0070707_100218275 3300005468 Bacteria 1858
20 Ga0070698_100160493 3300005471 Bacteria 2192
21 Ga0070698_100960450 3300005471 Bacteria 801
22 Ga0070699_100471350 3300005518 Bacteria 1139
23 Ga0070686_100227077 3300005544 Bacteria 1352
24 Ga0070686_100264879 3300005544 Bacteria 1261
25 Ga0070686_100625434 3300005544 Bacteria 851
26 Ga0070696_100138929 3300005546 Bacteria 1774
27 Ga0070665_100000098 3300005548 Bacteria 164407
28 Ga0070704_100287797 3300005549 Bacteria 1364
29 Ga0068855_100768771 3300005563 Bacteria 1026
30 Ga0068860_100750099 3300005843 Bacteria 988
31 Ga0068860_101348725 3300005843 Bacteria 734
32 Ga0068862_100940063 3300005844 Bacteria 852
33 Ga0081455_10037569 3300005937 Bacteria 4297
34 Ga0075428_100044779 3300006844 Bacteria 4862
35 Ga0075430_100129542 3300006846 Bacteria 2103
36 Ga0075433_10121661 3300006852 Bacteria 2318
37 Ga0075434_100017783 3300006871 Bacteria 6857
38 Ga0075434_100079550 3300006871 Bacteria 3274
39 Ga0075434_100171850 3300006871 Bacteria 2187
40 Ga0075434_100264447 3300006871 Bacteria 1739
41 Ga0075434_100504639 3300006871 Bacteria 1230
42 Ga0075434_101177267 3300006871 Bacteria 779
43 Ga0075436_100003735 3300006914 Bacteria 10435
44 Ga0075436_100046486 3300006914 Bacteria 2993
45 Ga0075435_100000512 3300007076 Bacteria 23675
46 Ga0105240_11306832 3300009093 Bacteria 765
47 Ga0111539_10162440 3300009094 Bacteria 2612
48 Ga0105247_10110480 3300009101 Bacteria 1769
49 Ga0105247_10268904 3300009101 Bacteria 1172
50 Ga0105242_10570563 3300009176 Bacteria 1088
51 Ga0105248_10446517 3300009177 Bacteria 1457
52 Ga0105249_10065971 3300009553 Bacteria 3332
53 Ga0105249_10710970 3300009553 Bacteria 1065
54 Ga0105249_11407060 3300009553 Bacteria 769
55 Ga0105239_10803935 3300010375 Bacteria 1077
56 Ga0105239_12124218 3300010375 Bacteria 653
57 Ga0157374_11045517 3300013296 Bacteria 836
58 Ga0163163_11865187 3300014325 Bacteria 661
59 Ga0157380_10161135 3300014326 Bacteria 1950
60 Ga0207692_10038494 3300025898 Bacteria 2346
61 Ga0207710_10094844 3300025900 Bacteria 1401
62 Ga0207680_10056664 3300025903 Bacteria 2368
63 Ga0207680_10236643 3300025903 Bacteria 1257
64 Ga0207645_10050177 3300025907 Bacteria 2664
65 Ga0207646_10339689 3300025922 Bacteria 1357
66 Ga0207646_10546000 3300025922 Bacteria 1042
67 Ga0207681_10000012 3300025923 Bacteria 361565
68 Ga0207700_11549068 3300025928 Bacteria 587
69 Ga0207686_10484912 3300025934 Bacteria 957
70 Ga0207669_10965556 3300025937 Bacteria 715
71 Ga0207665_10197505 3300025939 Bacteria 1464
72 Ga0207711_10438935 3300025941 Bacteria 1215
73 Ga0207651_10245004 3300025960 Bacteria 1463
74 Ga0207712_10061194 3300025961 Bacteria 2671
75 Ga0207640_10495984 3300025981 Bacteria 1016
76 Ga0207698_10700795 3300026142 Bacteria 1007
77 Ga0209983_1055899 3300027665 Bacteria 867
78 Ga0209998_10101655 3300027717 Bacteria 712
79 Ga0209974_10094767 3300027876 Bacteria 1038
80 Ga0268266_10000209 3300028379 Bacteria 102299
81 Ga0268266_10000644 3300028379 Bacteria 47499
82 Ga0268266_11355297 3300028379 Unclassified 687
83 Ga0268265_10545252 3300028380 Bacteria 1100
84 Ga0265328_10277533 3300031239 Bacteria 644
85 Ga0265340_10126005 3300031247 Bacteria 1177
86 Ga0307408_101508927 3300031548 Bacteria 636
87 Ga0307508_10073706 3300031616 Bacteria 2990
88 Ga0373936_0498893 3300035113 Bacteria 566
89 Ga0373961_0000379 3300035241 Bacteria 18908
90 Ga0373931_0543148 3300035691 Bacteria 754
91 Ga0373935_0001831 3300035692 Bacteria 11919
92 Ga0373947_0283384 3300035725 Bacteria 1102
93 Ga0439453_0128771 3300041408 Bacteria 586
94 Ga0451787_501099 3300041441 Bacteria 659
95 Ga0451807_1860966 3300041486 Bacteria 3257
96 Ga0451853_3212202 3300041512 Bacteria 1019
97 Ga0439452_075346 3300042010 Bacteria 740
98 Ga0451577_0617052 3300042876 Bacteria 984
99 Ga0453683_0136826 3300044673 Bacteria 1545
100 Ga0466963_0291627 3300044694 Bacteria 1147
101 Ga0453684_0001779 3300044712 Bacteria 57517
102 Ga0453684_0024944 3300044712 Bacteria 8705
103 Ga0451576_0835194 3300045051 Bacteria 967
104 Ga0466967_0524170 3300045976 Bacteria 1165
105 Ga0495613_0335193 3300046689 Unclassified 1042
106 Ga0495649_0258487 3300046694 Bacteria 893
107 Ga0495675_0193676 3300047444 Bacteria 1240
108 Ga0496114_0000067 3300048917 Bacteria 76074
109 Ga0496115_0075894 3300048918 Bacteria 2732
110 Ga0501034_0001340 3300049571 Bacteria 33293
111 Ga0501034_0010618 3300049571 Bacteria 9585
112 Ga0501034_1401871 3300049571 Bacteria 574
113 Ga0501036_0436839 3300049572 Bacteria 1091
114 Ga0501041_0581683 3300049577 Bacteria 714
115 Ga0501046_0166615 3300049580 Bacteria 1655
116 Ga0501047_0010403 3300049581 Bacteria 8803
117 Ga0501068_0052274 3300049584 Bacteria 2472
118 Ga0501070_0000566 3300049586 Bacteria 33724
119 Ga0501071_0909482 3300049587 Bacteria 679
120 Ga0501075_0005943 3300049591 Bacteria 8352
121 Ga0501075_1166091 3300049591 Bacteria 585
122 Ga0501076_0067122 3300049592 Bacteria 2864
123 Ga0501076_0447621 3300049592 Bacteria 1063
124 Ga0501077_0000652 3300049593 Bacteria 21065
125 Ga0501077_0666327 3300049593 Bacteria 668
126 Ga0501080_0083501 3300049742 Bacteria 2967
127 Ga0501081_0845959 3300049743 Bacteria 689
128 Ga0501083_0010502 3300049744 Bacteria 6516
129 Ga0501044_1037915 3300049823 Bacteria 690
130 nmdc:mga05p37_313039_c1 3300050507 Bacteria 1860
131 nmdc:mga0qj67_1169601_c1 3300050509 Bacteria 599
132 nmdc:mga08y16_647438_c1 3300050511 Bacteria 1061
133 nmdc:mga0n895_11172_c1 3300050512 Bacteria 7993
134 nmdc:mga0n895_140563_c1 3300050512 Bacteria 2443
135 nmdc:mga0n895_141904_c1 3300050512 Bacteria 2431
136 nmdc:mga0n895_183928_c1 3300050512 Bacteria 2121
137 nmdc:mga0n895_349421_c1 3300050512 Bacteria 1498
138 nmdc:mga0rr50_289036_c1 3300050513 Bacteria 1369
139 nmdc:mga0rr50_80_c1 3300050513 Bacteria 53811
140 nmdc:mga08x19_131158_c1 3300050514 Bacteria 1686
141 nmdc:mga08x19_2894_c1 3300050514 Bacteria 10332
142 nmdc:mga0a205_12095_c1 3300050515 Bacteria 7975
143 Ga0495601_0456908 3300053077 Bacteria 826
144 Ga0501084_0057164 3300054114 Bacteria 3265
145 Ga0501082_0001647 3300060353 Bacteria 19680
146 Ga0530510_0030476 3300061734 Bacteria 3875
147 2688392712 2687453341 Bacteria 6534136
148 Ga0070716_101510787
149 Ga0065707_10094706
150 Ga0070676_10015291
151 Ga0070690_100188203
152 Ga0070666_10067272
153 Ga0070682_100696838
154 Ga0068868_101183952
155 Ga0070687_100153516
156 Ga0070668_100254500
157 Ga0070669_100000011
158 Ga0070674_100671002
159 Ga0070673_100279082
160 Ga0070667_100026321
161 Ga0070703_10323358
162 Ga0070710_10051144
163 Ga0070701_10959871
164 Ga0070694_100413473
165 Ga0070706_100053070
166 Ga0070707_100218275
167 Ga0070698_100160493
168 Ga0070698_100960450
169 Ga0070699_100471350
170 Ga0070686_100227077
171 Ga0070686_100264879
172 Ga0070686_100625434
173 Ga0070696_100138929
174 Ga0070665_100000098
175 Ga0070704_100287797
176 Ga0068855_100768771
177 Ga0068860_100750099
178 Ga0068860_101348725
179 Ga0068862_100940063
180 Ga0081455_10037569
181 Ga0075428_100044779
182 Ga0075430_100129542
183 Ga0075433_10121661
184 Ga0075434_100017783
185 Ga0075434_100079550
186 Ga0075434_100171850
187 Ga0075434_100264447
188 Ga0075434_100504639
189 Ga0075434_101177267
190 Ga0075436_100003735
191 Ga0075436_100046486
192 Ga0075435_100000512
193 Ga0105240_11306832
194 Ga0111539_10162440
195 Ga0105247_10110480
196 Ga0105247_10268904
197 Ga0105242_10570563
198 Ga0105248_10446517
199 Ga0105249_10065971
200 Ga0105249_10710970
201 Ga0105249_11407060
202 Ga0105239_10803935
203 Ga0105239_12124218
204 Ga0157374_11045517
205 Ga0163163_11865187
206 Ga0157380_10161135
207 Ga0207692_10038494
208 Ga0207710_10094844
209 Ga0207680_10056664
210 Ga0207680_10236643
211 Ga0207645_10050177
212 Ga0207646_10339689
213 Ga0207646_10546000
214 Ga0207681_10000012
215 Ga0207700_11549068
216 Ga0207686_10484912
217 Ga0207669_10965556
218 Ga0207665_10197505
219 Ga0207711_10438935
220 Ga0207651_10245004
221 Ga0207712_10061194
222 Ga0207640_10495984
223 Ga0207698_10700795
224 Ga0209983_1055899
225 Ga0209998_10101655
226 Ga0209974_10094767
227 Ga0268266_10000209
228 Ga0268266_10000644
229 Ga0268266_11355297
230 Ga0268265_10545252
231 Ga0265328_10277533
232 Ga0265340_10126005
233 Ga0307408_101508927
234 Ga0307508_10073706
235 Ga0373936_0498893
236 Ga0373961_0000379
237 Ga0373931_0543148
238 Ga0373935_0001831
239 Ga0373947_0283384
240 Ga0439453_0128771
241 Ga0451787_501099
242 Ga0451807_1860966
243 Ga0451853_3212202
244 Ga0439452_075346
245 Ga0451577_0617052
246 Ga0453683_0136826
247 Ga0466963_0291627
248 Ga0453684_0001779
249 Ga0453684_0024944
250 Ga0451576_0835194
251 Ga0466967_0524170
252 Ga0495613_0335193
253 Ga0495649_0258487
254 Ga0495675_0193676
255 Ga0496114_0000067
256 Ga0496115_0075894
257 Ga0501034_0001340
258 Ga0501034_0010618
259 Ga0501034_1401871
260 Ga0501036_0436839
261 Ga0501041_0581683
262 Ga0501046_0166615
263 Ga0501047_0010403
264 Ga0501068_0052274
265 Ga0501070_0000566
266 Ga0501071_0909482
267 Ga0501075_0005943
268 Ga0501075_1166091
269 Ga0501076_0067122
270 Ga0501076_0447621
271 Ga0501077_0000652
272 Ga0501077_0666327
273 Ga0501080_0083501
274 Ga0501081_0845959
275 Ga0501083_0010502
276 Ga0501044_1037915
277 nmdc:mga05p37_313039_c1
278 nmdc:mga0qj67_1169601_c1
279 nmdc:mga08y16_647438_c1
280 nmdc:mga0n895_11172_c1
281 nmdc:mga0n895_140563_c1
282 nmdc:mga0n895_141904_c1
283 nmdc:mga0n895_183928_c1
284 nmdc:mga0n895_349421_c1
285 nmdc:mga0rr50_289036_c1
286 nmdc:mga0rr50_80_c1
287 nmdc:mga08x19_131158_c1
288 nmdc:mga08x19_2894_c1
289 nmdc:mga0a205_12095_c1
290 Ga0495601_0456908
291 Ga0501084_0057164
292 Ga0501082_0001647
293 Ga0530510_0030476
294 2688392712

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

12

141

0.99

PF08534

Redoxin

Redoxin

11

158

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5enu-assembly2.cif.gz_B crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria 0.9506 3 156
5enu-assembly2.cif.gz_B crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria 0.9446 3 156
4eo3-assembly1.cif.gz_B peroxiredoxin nitroreductase fusion enzyme 0.9382 9 158
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.9271 5 161
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.9212 5 161
ID Description Score Start End Superfamily
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9894 6 153 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9764 6 153 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9698 5 155 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9513 5 155 3.40.30.10
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9481 5 154 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A5C6AGX7-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9987 1 156 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A2R6C526-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9946 32 152 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A432TGI5-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9943 5 94 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A074LGD0-F1-model_v4 Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant domain-containing protein 0.9939 59 156 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A5Q4ESY9-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9938 3 156 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Map