F199779

General Info

Members Datasets Scaffolds Average Seq Length
147 111 147 177

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100039421|Ga0070684_1000394215
Length 189
Sequence MSALAVAPAPPIQDPRLAGDVLAHLEAQLQSTQRLLHSVLAQGVAIRAQDVDGVVRQVAAFQAELERRARLEEDRARLLARAGAQLGTAPHAVTLSQLSALMTPHDAALATARSAELQGLLAELQREHACNQALMRQELAFLDHLLRLVGAGGMGPGDAGAYTANGIRPAAHMPHTTVRTGPRALDLQA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
59 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
62 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
65 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
66 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
74 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
82 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
83 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
88 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
89 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
90 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
91 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
94 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
109 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
110 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
111 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 17.69
Rhizosphere 80.27
Stem 0
Stem Tuber 0
Unclassified 2.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100353895 3300005329 Bacteria 1398
2 Ga0070660_100042215 3300005339 Bacteria 3480
3 Ga0070692_10017073 3300005345 Bacteria 3463
4 Ga0070669_100367540 3300005353 Bacteria 1171
5 Ga0070659_100000002 3300005366 Bacteria 369239
6 Ga0070714_100000087 3300005435 Bacteria 78107
7 Ga0070714_100052744 3300005435 Bacteria 3470
8 Ga0070714_100127937 3300005435 Bacteria 2267
9 Ga0070710_10000007 3300005437 Bacteria 215320
10 Ga0070701_10374214 3300005438 Bacteria 896
11 Ga0070694_100274105 3300005444 Bacteria 1284
12 Ga0068867_101560765 3300005459 Bacteria 616
13 Ga0070679_100348396 3300005530 Bacteria 1429
14 Ga0070684_100039421 3300005535 Bacteria 4063
15 Ga0070684_100302756 3300005535 Bacteria 1467
16 Ga0070672_101021134 3300005543 Bacteria 733
17 Ga0068855_100514211 3300005563 Bacteria 1300
18 Ga0068854_100653346 3300005578 Bacteria 903
19 Ga0068856_100018797 3300005614 Bacteria 6701
20 Ga0070702_100147544 3300005615 Bacteria 1506
21 Ga0068864_100746373 3300005618 Bacteria 959
22 Ga0068862_101257703 3300005844 Bacteria 740
23 Ga0081455_10021844 3300005937 Bacteria 5994
24 Ga0081455_10392122 3300005937 Bacteria 966
25 Ga0081540_1000626 3300005983 Bacteria 33632
26 Ga0081539_10003784 3300005985 Bacteria 17870
27 Ga0070717_10000024 3300006028 Bacteria 158890
28 Ga0070717_10018080 3300006028 Bacteria 5499
29 Ga0070715_10449387 3300006163 Bacteria 727
30 Ga0070712_100000072 3300006175 Bacteria 51993
31 Ga0075431_100520664 3300006847 Bacteria 1179
32 Ga0075429_100008073 3300006880 Bacteria 9150
33 Ga0105245_10357521 3300009098 Unclassified 1449
34 Ga0105245_11453680 3300009098 Bacteria 736
35 Ga0105243_10499783 3300009148 Bacteria 1152
36 Ga0105239_10045969 3300010375 Bacteria 4784
37 Ga0105239_12578011 3300010375 Unclassified 593
38 Ga0105246_10081392 3300011119 Bacteria 2308
39 Ga0157378_11039546 3300013297 Bacteria 854
40 Ga0157372_10549212 3300013307 Bacteria 1347
41 Ga0163163_10406165 3300014325 Bacteria 1420
42 Ga0213876_10115361 3300021384 Bacteria 1425
43 Ga0207692_10000001 3300025898 Bacteria 558345
44 Ga0207688_10115146 3300025901 Bacteria 1564
45 Ga0207695_10128268 3300025913 Bacteria 2496
46 Ga0207693_10000001 3300025915 Bacteria 469535
47 Ga0207657_10093030 3300025919 Bacteria 2512
48 Ga0207657_10418320 3300025919 Bacteria 1054
49 Ga0207649_10193495 3300025920 Bacteria 1432
50 Ga0207652_10446745 3300025921 Bacteria 1165
51 Ga0207681_10080187 3300025923 Bacteria 2302
52 Ga0207687_10138663 3300025927 Unclassified 1842
53 Ga0207664_10000008 3300025929 Bacteria 309301
54 Ga0207664_10025446 3300025929 Bacteria 4459
55 Ga0207664_10046003 3300025929 Bacteria 3425
56 Ga0207644_10285255 3300025931 Bacteria 1327
57 Ga0207690_10000024 3300025932 Bacteria 194416
58 Ga0207706_10624854 3300025933 Bacteria 924
59 Ga0207670_10712964 3300025936 Bacteria 831
60 Ga0207689_10242035 3300025942 Bacteria 1491
61 Ga0207667_10601872 3300025949 Bacteria 1108
62 Ga0207668_10187940 3300025972 Bacteria 1635
63 Ga0207708_10362943 3300026075 Bacteria 1191
64 Ga0207702_10203113 3300026078 Unclassified 1838
65 Ga0207648_10427612 3300026089 Bacteria 1203
66 Ga0207675_100275839 3300026118 Bacteria 1633
67 Ga0268265_10746800 3300028380 Bacteria 949
68 Ga0265326_10000004 3300028558 Bacteria 283947
69 Ga0265319_1000069 3300028563 Bacteria 82640
70 Ga0265319_1000641 3300028563 Bacteria 23071
71 Ga0265334_10000512 3300028573 Bacteria 19858
72 Ga0265318_10106022 3300028577 Unclassified 1034
73 Ga0265336_10004286 3300028666 Bacteria 5422
74 Ga0265338_10004903 3300028800 Bacteria 17808
75 Ga0265324_10001762 3300029957 Bacteria 11877
76 Ga0265320_10140508 3300031240 Bacteria 1094
77 Ga0265314_10274676 3300031711 Bacteria 956
78 Ga0307413_10005585 3300031824 Bacteria 5634
79 Ga0307410_10190951 3300031852 Unclassified 1557
80 Ga0307410_10251510 3300031852 Unclassified 1374
81 Ga0307406_10959221 3300031901 Bacteria 731
82 Ga0307407_10099655 3300031903 Bacteria 1800
83 Ga0307407_10286794 3300031903 Unclassified 1142
84 Ga0307416_100259553 3300032002 Bacteria 1697
85 Ga0307416_100691146 3300032002 Unclassified 1108
86 Ga0307411_10223007 3300032005 Bacteria 1464
87 Ga0373936_0232841 3300035113 Bacteria 820
88 Ga0373946_0076961 3300035171 Bacteria 1453
89 Ga0373935_0093127 3300035692 Unclassified 1976
90 Ga0395900_0018531 3300037418 Bacteria 7099
91 Ga0395900_0855241 3300037418 Bacteria 835
92 Ga0395898_0000490 3300037466 Bacteria 78132
93 Ga0395898_0097117 3300037466 Bacteria 2830
94 Ga0436364_0561556 3300037853 Bacteria 1259
95 Ga0395901_0484767 3300038443 Bacteria 1261
96 Ga0395901_1390305 3300038443 Bacteria 661
97 Ga0436365_1715172 3300039437 Bacteria 9316
98 Ga0466966_0105904 3300044684 Bacteria 1736
99 Ga0466966_0128633 3300044684 Bacteria 1552
100 Ga0466961_0086850 3300044693 Bacteria 1977
101 Ga0466961_0595464 3300044693 Bacteria 665
102 Ga0466960_0355818 3300044901 Bacteria 836
103 Ga0466959_0028590 3300045049 Bacteria 4134
104 Ga0466959_0082003 3300045049 Bacteria 2324
105 Ga0466959_0118929 3300045049 Bacteria 1880
106 Ga0466958_0117251 3300045836 Bacteria 1665
107 Ga0466958_0274266 3300045836 Unclassified 1080
108 Ga0466958_0282892 3300045836 Bacteria 1063
109 Ga0466958_0290495 3300045836 Bacteria 1049
110 Ga0466958_0458187 3300045836 Bacteria 826
111 Ga0495603_0070213 3300046455 Bacteria 2059
112 Ga0495590_0027963 3300046457 Bacteria 1978
113 Ga0495639_0161077 3300046475 Bacteria 1086
114 Ga0495584_0066224 3300046491 Bacteria 1817
115 Ga0495589_0103662 3300046794 Bacteria 1375
116 Ga0495581_0086288 3300047315 Bacteria 1820
117 Ga0495672_0011374 3300047320 Bacteria 6287
118 Ga0496100_0009852 3300048903 Bacteria 5385
119 Ga0496101_0004711 3300048904 Bacteria 8638
120 Ga0496101_0055196 3300048904 Bacteria 2869
121 Ga0496101_0413832 3300048904 Unclassified 1062
122 Ga0496102_0018486 3300048905 Bacteria 6126
123 Ga0496103_0221029 3300048906 Bacteria 1218
124 Ga0496104_0011251 3300048907 Bacteria 8008
125 Ga0496104_0074228 3300048907 Bacteria 3238
126 Ga0496106_0216741 3300048909 Bacteria 1526
127 Ga0496107_0025955 3300048910 Bacteria 4152
128 Ga0496108_0004312 3300048911 Bacteria 11440
129 Ga0496108_0118075 3300048911 Bacteria 2273
130 Ga0496108_0499874 3300048911 Bacteria 1062
131 Ga0496109_0057111 3300048912 Bacteria 3561
132 Ga0496109_0123270 3300048912 Bacteria 2415
133 Ga0496110_0018253 3300048913 Bacteria 5880
134 Ga0496110_0061501 3300048913 Bacteria 3314
135 Ga0496111_0008020 3300048914 Bacteria 6965
136 Ga0496112_0004385 3300048915 Bacteria 11940
137 Ga0496112_0017072 3300048915 Bacteria 6814
138 Ga0496112_0090153 3300048915 Bacteria 3035
139 Ga0496113_0010071 3300048916 Bacteria 6235
140 Ga0496113_0011269 3300048916 Bacteria 5955
141 Ga0496114_0341645 3300048917 Bacteria 1324
142 Ga0496115_0431851 3300048918 Bacteria 1066
143 Ga0496115_0586906 3300048918 Bacteria 887
144 Ga0501072_0246765 3300049588 Bacteria 1422
145 nmdc:mga09592_3659_c1 3300050508 Bacteria 12395
146 nmdc:mga0a205_841263_c1 3300050515 Bacteria 765
147 Ga0501084_0724912 3300054114 Bacteria 838

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005353 Ga0070669_100367540 Ga0070669_1003675402 150
2 3300005444 Ga0070694_100274105 Ga0070694_1002741052 150
3 3300005844 Ga0068862_101257703 Ga0068862_1012577032 150
4 3300025923 Ga0207681_10080187 Ga0207681_100801874 150
5 3300025972 Ga0207668_10187940 Ga0207668_101879402 150
6 3300028380 Ga0268265_10746800 Ga0268265_107468002 150
7 3300025936 Ga0207670_10712964 Ga0207670_107129642 157
8 3300037466 Ga0395898_0097117 Ga0395898_0097117_629_1111 160
9 3300037418 Ga0395900_0855241 Ga0395900_0855241_108_599 163
10 3300005530 Ga0070679_100348396 Ga0070679_1003483962 165
11 3300005535 Ga0070684_100302756 Ga0070684_1003027562 165
12 3300025921 Ga0207652_10446745 Ga0207652_104467453 165
13 3300038443 Ga0395901_0484767 Ga0395901_0484767_45_542 165
14 3300005937 Ga0081455_10021844 Ga0081455_100218446 166
15 3300045836 Ga0466958_0282892 Ga0466958_0282892_172_672 166
16 3300031852 Ga0307410_10251510 Ga0307410_102515103 171
17 3300031901 Ga0307406_10959221 Ga0307406_109592212 171
18 3300032002 Ga0307416_100259553 Ga0307416_1002595532 171
19 3300032005 Ga0307411_10223007 Ga0307411_102230072 171
20 3300049588 Ga0501072_0246765 Ga0501072_0246765_259_777 171
21 3300054114 Ga0501084_0724912 Ga0501084_0724912_276_794 171
22 3300005578 Ga0068854_100653346 Ga0068854_1006533463 172
23 3300005937 Ga0081455_10392122 Ga0081455_103921222 172
24 3300005985 Ga0081539_10003784 Ga0081539_1000378416 172
25 3300010375 Ga0105239_12578011 Ga0105239_125780111 172
26 3300005459 Ga0068867_101560765 Ga0068867_1015607651 173
27 3300005618 Ga0068864_100746373 Ga0068864_1007463732 173
28 3300005983 Ga0081540_1000626 Ga0081540_100062616 173
29 3300006847 Ga0075431_100520664 Ga0075431_1005206643 173
30 3300009098 Ga0105245_11453680 Ga0105245_114536802 173
31 3300045049 Ga0466959_0028590 Ga0466959_0028590_3581_4105 173
32 3300031824 Ga0307413_10005585 Ga0307413_100055859 174
33 3300031852 Ga0307410_10190951 Ga0307410_101909513 174
34 3300031903 Ga0307407_10099655 Ga0307407_100996552 174
35 3300031903 Ga0307407_10286794 Ga0307407_102867942 174
36 3300032002 Ga0307416_100691146 Ga0307416_1006911462 174
37 3300037418 Ga0395900_0018531 Ga0395900_0018531_4127_4678 174
38 3300037466 Ga0395898_0000490 Ga0395898_0000490_64182_64733 174
39 3300038443 Ga0395901_1390305 Ga0395901_1390305_61_612 174
40 3300009148 Ga0105243_10499783 Ga0105243_104997832 175
41 3300045836 Ga0466958_0290495 Ga0466958_0290495_411_941 175
42 3300006175 Ga0070712_100000072 Ga0070712_1000000727 176
43 3300025915 Ga0207693_10000001 Ga0207693_10000001167 176
44 3300044901 Ga0466960_0355818 Ga0466960_0355818_95_628 176
45 3300045049 Ga0466959_0118929 Ga0466959_0118929_626_1159 176
46 3300045836 Ga0466958_0274266 Ga0466958_0274266_176_718 176
47 3300048915 Ga0496112_0004385 Ga0496112_0004385_5143_5673 176
48 3300005435 Ga0070714_100127937 Ga0070714_1001279372 177
49 3300005438 Ga0070701_10374214 Ga0070701_103742142 177
50 3300005543 Ga0070672_101021134 Ga0070672_1010211341 177
51 3300005563 Ga0068855_100514211 Ga0068855_1005142112 177
52 3300005614 Ga0068856_100018797 Ga0068856_1000187976 177
53 3300005615 Ga0070702_100147544 Ga0070702_1001475442 177
54 3300006163 Ga0070715_10449387 Ga0070715_104493871 177
55 3300009098 Ga0105245_10357521 Ga0105245_103575211 177
56 3300013297 Ga0157378_11039546 Ga0157378_110395461 177
57 3300013307 Ga0157372_10549212 Ga0157372_105492123 177
58 3300021384 Ga0213876_10115361 Ga0213876_101153612 177
59 3300025901 Ga0207688_10115146 Ga0207688_101151463 177
60 3300025919 Ga0207657_10418320 Ga0207657_104183202 177
61 3300025920 Ga0207649_10193495 Ga0207649_101934952 177
62 3300025927 Ga0207687_10138663 Ga0207687_101386632 177
63 3300025931 Ga0207644_10285255 Ga0207644_102852553 177
64 3300025933 Ga0207706_10624854 Ga0207706_106248542 177
65 3300025942 Ga0207689_10242035 Ga0207689_102420352 177
66 3300025949 Ga0207667_10601872 Ga0207667_106018722 177
67 3300026075 Ga0207708_10362943 Ga0207708_103629433 177
68 3300026078 Ga0207702_10203113 Ga0207702_102031134 177
69 3300026089 Ga0207648_10427612 Ga0207648_104276122 177
70 3300026118 Ga0207675_100275839 Ga0207675_1002758392 177
71 3300035113 Ga0373936_0232841 Ga0373936_0232841_110_646 177
72 3300035171 Ga0373946_0076961 Ga0373946_0076961_394_930 177
73 3300035692 Ga0373935_0093127 Ga0373935_0093127_892_1428 177
74 3300037853 Ga0436364_0561556 Ga0436364_0561556_487_1023 177
75 3300039437 Ga0436365_1715172 Ga0436365_1715172_18_554 177
76 3300044684 Ga0466966_0105904 Ga0466966_0105904_1013_1549 177
77 3300044693 Ga0466961_0595464 Ga0466961_0595464_96_632 177
78 3300045049 Ga0466959_0082003 Ga0466959_0082003_834_1370 177
79 3300045836 Ga0466958_0117251 Ga0466958_0117251_77_637 177
80 3300045836 Ga0466958_0458187 Ga0466958_0458187_226_762 177
81 3300046455 Ga0495603_0070213 Ga0495603_0070213_196_732 177
82 3300046457 Ga0495590_0027963 Ga0495590_0027963_336_872 177
83 3300046491 Ga0495584_0066224 Ga0495584_0066224_660_1196 177
84 3300046794 Ga0495589_0103662 Ga0495589_0103662_204_740 177
85 3300047315 Ga0495581_0086288 Ga0495581_0086288_828_1364 177
86 3300048903 Ga0496100_0009852 Ga0496100_0009852_3799_4341 177
87 3300048904 Ga0496101_0004711 Ga0496101_0004711_5321_5863 177
88 3300048904 Ga0496101_0055196 Ga0496101_0055196_628_1164 177
89 3300048904 Ga0496101_0413832 Ga0496101_0413832_462_998 177
90 3300048905 Ga0496102_0018486 Ga0496102_0018486_2276_2812 177
91 3300048906 Ga0496103_0221029 Ga0496103_0221029_59_595 177
92 3300048907 Ga0496104_0011251 Ga0496104_0011251_5855_6391 177
93 3300048907 Ga0496104_0074228 Ga0496104_0074228_698_1234 177
94 3300048909 Ga0496106_0216741 Ga0496106_0216741_650_1192 177
95 3300048910 Ga0496107_0025955 Ga0496107_0025955_1629_2165 177
96 3300048911 Ga0496108_0004312 Ga0496108_0004312_8379_8915 177
97 3300048911 Ga0496108_0118075 Ga0496108_0118075_204_740 177
98 3300048912 Ga0496109_0057111 Ga0496109_0057111_701_1237 177
99 3300048912 Ga0496109_0123270 Ga0496109_0123270_1722_2258 177
100 3300048913 Ga0496110_0018253 Ga0496110_0018253_4887_5423 177
101 3300048913 Ga0496110_0061501 Ga0496110_0061501_1203_1739 177
102 3300048914 Ga0496111_0008020 Ga0496111_0008020_5103_5639 177
103 3300048915 Ga0496112_0017072 Ga0496112_0017072_2601_3137 177
104 3300048915 Ga0496112_0090153 Ga0496112_0090153_1537_2073 177
105 3300048916 Ga0496113_0011269 Ga0496113_0011269_4940_5476 177
106 3300048917 Ga0496114_0341645 Ga0496114_0341645_568_1104 177
107 3300048918 Ga0496115_0431851 Ga0496115_0431851_423_959 177
108 3300048918 Ga0496115_0586906 Ga0496115_0586906_295_831 177
109 3300006028 Ga0070717_10018080 Ga0070717_100180804 178
110 3300025913 Ga0207695_10128268 Ga0207695_101282683 178
111 3300025929 Ga0207664_10025446 Ga0207664_100254463 178
112 3300047320 Ga0495672_0011374 Ga0495672_0011374_4447_4986 178
113 3300048911 Ga0496108_0499874 Ga0496108_0499874_307_846 178
114 3300028563 Ga0265319_1000069 Ga0265319_10000698 179
115 3300006880 Ga0075429_100008073 Ga0075429_1000080733 180
116 3300044684 Ga0466966_0128633 Ga0466966_0128633_205_753 180
117 3300044693 Ga0466961_0086850 Ga0466961_0086850_1167_1715 180
118 3300048916 Ga0496113_0010071 Ga0496113_0010071_2660_3211 180
119 3300050508 nmdc:mga09592_3659_c1 nmdc:mga09592_3659_c1_3732_4280 180
120 3300050515 nmdc:mga0a205_841263_c1 nmdc:mga0a205_841263_c1_145_687 180
121 3300005435 Ga0070714_100000087 Ga0070714_10000008770 181
122 3300005435 Ga0070714_100052744 Ga0070714_1000527444 181
123 3300006028 Ga0070717_10000024 Ga0070717_1000002444 181
124 3300025929 Ga0207664_10000008 Ga0207664_10000008104 181
125 3300025929 Ga0207664_10046003 Ga0207664_100460032 181
126 3300028558 Ga0265326_10000004 Ga0265326_10000004142 181
127 3300028563 Ga0265319_1000641 Ga0265319_100064127 181
128 3300028573 Ga0265334_10000512 Ga0265334_1000051211 181
129 3300028666 Ga0265336_10004286 Ga0265336_100042869 181
130 3300028800 Ga0265338_10004903 Ga0265338_100049038 181
131 3300029957 Ga0265324_10001762 Ga0265324_1000176218 181
132 3300031240 Ga0265320_10140508 Ga0265320_101405082 181
133 3300031711 Ga0265314_10274676 Ga0265314_102746762 181
134 3300028577 Ga0265318_10106022 Ga0265318_101060222 182
135 3300010375 Ga0105239_10045969 Ga0105239_100459696 183
136 3300046475 Ga0495639_0161077 Ga0495639_0161077_30_596 183
137 3300005339 Ga0070660_100042215 Ga0070660_1000422152 184
138 3300005366 Ga0070659_100000002 Ga0070659_100000002127 184
139 3300005437 Ga0070710_10000007 Ga0070710_10000007110 184
140 3300011119 Ga0105246_10081392 Ga0105246_100813922 184
141 3300025898 Ga0207692_10000001 Ga0207692_10000001339 184
142 3300025919 Ga0207657_10093030 Ga0207657_100930302 184
143 3300025932 Ga0207690_10000024 Ga0207690_1000002464 184
144 3300005329 Ga0070683_100353895 Ga0070683_1003538952 186
145 3300005345 Ga0070692_10017073 Ga0070692_100170732 186
146 3300005535 Ga0070684_100039421 Ga0070684_1000394215 186
147 3300014325 Ga0163163_10406165 Ga0163163_104061652 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05130

FlgN

FlgN protein

17

169

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fup-assembly1.cif.gz_A crystal structure of a putative flagella synthesis protein flgn (pa3352) from pseudomonas aeruginosa at 1.48 a resolution 0.7673 9 135
2fup-assembly1.cif.gz_A crystal structure of a putative flagella synthesis protein flgn (pa3352) from pseudomonas aeruginosa at 1.48 a resolution 0.7101 9 135
3h3m-assembly1.cif.gz_A crystal structure of flagellar protein flit from bordetella bronchiseptica 0.6616 18 142
3k1s-assembly1.cif.gz_A crystal structure of the pts cellobiose specific enzyme iia from bacillus anthracis 0.6534 15 135
3h3m-assembly1.cif.gz_A crystal structure of flagellar protein flit from bordetella bronchiseptica 0.6394 18 142
ID Description Score Start End Superfamily
af_Q8LA67_1_303_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8546 13 79 1.25.10.10
4zxlA03 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Hyaluronidase post-catalytic domain-like 0.6757 13 63 1.20.58.460
af_K7M812_36_117_1.10.287.130 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.6474 15 71 1.10.287.130
af_O94651_10_125_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.647 16 141 1.20.58.70
af_P39926_34_229_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6463 15 152 1.20.58.70
ID Description Score Start End GO Terms
AF-A0A653A3C3-F1-model_v4 Uncharacterized protein 0.9624 14 146 GO:0044780
AF-A0A2E5YLQ8-F1-model_v4 DUF222 domain-containing protein 0.9472 9 147
AF-A0A2M7AKC0-F1-model_v4 Flagellar protein FlgN 0.9439 9 141 GO:0044780
AF-A0A1M6AQ27-F1-model_v4 FlgN protein 0.9413 14 146 GO:0044780
AF-A0A5N8Z4T5-F1-model_v4 Flagellar protein FlgN 0.94 14 147 GO:0044780

Feature Viewer

pLDDT pTM Quality
82.64 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map