F199193

General Info

Members Datasets Scaffolds Average Seq Length
147 88 294 161

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10302245|rootH1_103022451
Length 165
Sequence MNELLSNLIEALREELKQYGEMLALLDQQQQLVMQRQVAELPANVTSVNAQAGVIAVARQEREQRQRHLTRFFQLPESAGFKALIPLLPADYRPLLDALVQENNELLVRVQQRARQNHLMLSHCVELMQQLINSIFPSVSPTTYDGSGHIPAAVVAPQPLYQAVG

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
27 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
28 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
29 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
38 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
39 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
40 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
41 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
42 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
43 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
44 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
45 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
46 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
47 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
48 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
49 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
50 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
51 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
52 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
53 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
54 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
55 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
56 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
57 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
58 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
59 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
60 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
61 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
62 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
63 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
64 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
65 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
66 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
67 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
68 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
69 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
70 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
71 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
72 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
73 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
74 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
75 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
76 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
77 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
78 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
79 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
85 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
87 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
88 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 0
Rhizosphere 98.64
Stem 0
Stem Tuber 0
Unclassified 42.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10302245 3300003323 Bacteria 2003
2 Ga0065715_10295141 3300005293 Bacteria 1054
3 Ga0070689_100044638 3300005340 Bacteria 3410
4 Ga0070688_100068501 3300005365 Bacteria 2263
5 Ga0070714_100030630 3300005435 Unclassified 4481
6 Ga0070713_100690158 3300005436 Unclassified 974
7 Ga0070700_100658907 3300005441 Bacteria 827
8 Ga0070681_10029684 3300005458 Bacteria 5490
9 Ga0070706_100908526 3300005467 Unclassified 813
10 Ga0070698_101315264 3300005471 Unclassified 673
11 Ga0070679_101083327 3300005530 Unclassified 746
12 Ga0070696_101267642 3300005546 Unclassified 625
13 Ga0068857_100102576 3300005577 Bacteria 2568
14 Ga0068857_100163351 3300005577 Bacteria 2021
15 Ga0068856_100327525 3300005614 Bacteria 1549
16 Ga0068859_100750418 3300005617 Unclassified 1065
17 Ga0068859_100959020 3300005617 Unclassified 938
18 Ga0068864_100199784 3300005618 Bacteria 1836
19 Ga0068870_10186994 3300005840 Bacteria 1247
20 Ga0068863_100215507 3300005841 Bacteria 1849
21 Ga0075429_100204293 3300006880 Unclassified 1731
22 Ga0097620_100750347 3300006931 Unclassified 1065
23 Ga0097620_100959196 3300006931 Unclassified 938
24 Ga0105240_11540329 3300009093 Unclassified 696
25 Ga0105242_10722870 3300009176 Bacteria 977
26 Ga0105248_10401101 3300009177 Unclassified 1544
27 Ga0105238_10099019 3300009551 Bacteria 2899
28 Ga0157374_10749042 3300013296 Unclassified 991
29 Ga0157375_10907641 3300013308 Unclassified 1025
30 Ga0157375_11134167 3300013308 Bacteria 916
31 Ga0157375_13177725 3300013308 Unclassified 548
32 Ga0163163_10274024 3300014325 Bacteria 1738
33 Ga0163163_10289398 3300014325 Bacteria 1690
34 Ga0157377_10235757 3300014745 Bacteria 1179
35 Ga0207705_10326612 3300025909 Unclassified 1179
36 Ga0207707_10091024 3300025912 Bacteria 2666
37 Ga0207646_11148211 3300025922 Unclassified 682
38 Ga0207664_10025230 3300025929 Unclassified 4475
39 Ga0207670_10089830 3300025936 Bacteria 2169
40 Ga0207711_10533487 3300025941 Unclassified 1094
41 Ga0207711_10624384 3300025941 Unclassified 1005
42 Ga0207708_10514181 3300026075 Bacteria 1005
43 Ga0207674_10180733 3300026116 Bacteria 2061
44 Ga0265337_1001030 3300028556 Bacteria 14474
45 Ga0265337_1002055 3300028556 Bacteria 9524
46 Ga0265337_1005729 3300028556 Unclassified 4882
47 Ga0265337_1014963 3300028556 Bacteria 2557
48 Ga0265337_1025585 3300028556 Unclassified 1796
49 Ga0265326_10005347 3300028558 Unclassified 4046
50 Ga0265326_10097048 3300028558 Unclassified 836
51 Ga0265326_10100744 3300028558 Unclassified 819
52 Ga0265326_10237694 3300028558 Unclassified 525
53 Ga0265334_10035818 3300028573 Bacteria 1962
54 Ga0265336_10001747 3300028666 Bacteria 9533
55 Ga0265336_10014788 3300028666 Unclassified 2580
56 Ga0265338_10000036 3300028800 Bacteria 238689
57 Ga0265338_10000248 3300028800 Bacteria 98976
58 Ga0265338_10000336 3300028800 Bacteria 85530
59 Ga0265338_10000879 3300028800 Bacteria 50689
60 Ga0265338_10001440 3300028800 Bacteria 38646
61 Ga0265338_10001655 3300028800 Bacteria 35519
62 Ga0265338_10004498 3300028800 Bacteria 18798
63 Ga0265338_10005363 3300028800 Bacteria 16764
64 Ga0265338_10005601 3300028800 Bacteria 16323
65 Ga0265338_10040180 3300028800 Unclassified 4399
66 Ga0265338_10045153 3300028800 Unclassified 4056
67 Ga0265338_10160191 3300028800 Unclassified 1739
68 Ga0265338_10226999 3300028800 Unclassified 1391
69 Ga0265338_10390509 3300028800 Unclassified 994
70 Ga0265324_10000702 3300029957 Bacteria 22335
71 Ga0265324_10000718 3300029957 Bacteria 22026
72 Ga0265324_10006414 3300029957 Bacteria 4911
73 Ga0265324_10078035 3300029957 Bacteria 1127
74 Ga0265332_10018772 3300031238 Bacteria 3053
75 Ga0265332_10073880 3300031238 Bacteria 1450
76 Ga0265320_10000809 3300031240 Bacteria 23740
77 Ga0265320_10007539 3300031240 Bacteria 6748
78 Ga0265320_10022118 3300031240 Bacteria 3408
79 Ga0265320_10134074 3300031240 Bacteria 1124
80 Ga0265320_10212192 3300031240 Unclassified 863
81 Ga0265320_10280831 3300031240 Unclassified 737
82 Ga0265325_10205725 3300031241 Bacteria 906
83 Ga0265329_10000522 3300031242 Bacteria 19833
84 Ga0265339_10292419 3300031249 Bacteria 778
85 Ga0265339_10328885 3300031249 Unclassified 724
86 Ga0265339_10341743 3300031249 Unclassified 707
87 Ga0265331_10173319 3300031250 Bacteria 976
88 Ga0265331_10239427 3300031250 Unclassified 814
89 Ga0265327_10010120 3300031251 Bacteria 6682
90 Ga0265316_10083731 3300031344 Bacteria 2443
91 Ga0265316_10177169 3300031344 Bacteria 1588
92 Ga0265316_10369866 3300031344 Bacteria 1035
93 Ga0265314_10000037 3300031711 Bacteria 225790
94 Ga0265314_10004043 3300031711 Bacteria 13855
95 Ga0265314_10254338 3300031711 Unclassified 1007
96 Ga0265314_10289842 3300031711 Unclassified 922
97 Ga0265314_10316680 3300031711 Unclassified 869
98 Ga0373957_0156953 3300035120 Unclassified 936
99 Ga0373927_0003806 3300035695 Bacteria 10706
100 Ga0373927_0973960 3300035695 Unclassified 560
101 Ga0373937_0350149 3300036401 Unclassified 1399
102 Ga0373925_0515957 3300037068 Unclassified 982
103 Ga0373925_0571595 3300037068 Bacteria 930
104 Ga0451577_0029894 3300042876 Bacteria 4923
105 Ga0451577_0141801 3300042876 Bacteria 2160
106 Ga0451577_0694854 3300042876 Unclassified 921
107 Ga0453684_0012301 3300044712 Bacteria 14161
108 Ga0451576_0083398 3300045051 Unclassified 3325
109 Ga0495592_0000315 3300046454 Bacteria 40668
110 Ga0495641_0046471 3300046461 Bacteria 1996
111 Ga0495580_0566945 3300046472 Unclassified 753
112 Ga0495664_0057763 3300046477 Bacteria 2308
113 Ga0495594_0295608 3300046499 Unclassified 923
114 Ga0495618_0001520 3300046514 Bacteria 15572
115 Ga0495628_0000127 3300046516 Bacteria 63790
116 Ga0495628_0481670 3300046516 Bacteria 898
117 Ga0495630_0030703 3300046517 Unclassified 3999
118 Ga0495630_0134277 3300046517 Bacteria 1880
119 Ga0495666_0006699 3300046526 Bacteria 5794
120 Ga0495652_0067844 3300046529 Bacteria 2989
121 Ga0495640_0189380 3300046533 Bacteria 1308
122 Ga0495586_0000930 3300046535 Bacteria 16619
123 Ga0495586_0029698 3300046535 Unclassified 2926
124 Ga0495621_0064161 3300046539 Unclassified 1340
125 Ga0495634_0037814 3300046642 Bacteria 3296
126 Ga0495634_0151277 3300046642 Bacteria 1468
127 Ga0495599_0191116 3300046678 Bacteria 1259
128 Ga0495647_0083100 3300046681 Unclassified 1301
129 Ga0495658_0264712 3300046683 Unclassified 1083
130 Ga0495624_0016355 3300046690 Unclassified 4993
131 Ga0495624_0125024 3300046690 Unclassified 1579
132 Ga0495674_0014682 3300047319 Bacteria 7329
133 Ga0495674_0098207 3300047319 Unclassified 2494
134 Ga0495676_0045042 3300047321 Unclassified 3595
135 Ga0501032_0050845 3300049569 Bacteria 2795
136 Ga0501033_0019563 3300049570 Bacteria 5119
137 Ga0501034_0375694 3300049571 Bacteria 1347
138 Ga0501034_0504499 3300049571 Bacteria 1123
139 Ga0501043_0347679 3300049579 Unclassified 1127
140 Ga0501047_0321212 3300049581 Bacteria 1388
141 Ga0501080_0022769 3300049742 Bacteria 5804
142 Ga0501080_0674162 3300049742 Bacteria 913
143 Ga0501035_0012545 3300049822 Bacteria 7828
144 Ga0501035_0228594 3300049822 Unclassified 1586
145 Ga0501044_0014462 3300049823 Bacteria 8518
146 nmdc:mga09592_151886_c1 3300050508 Unclassified 1998
147 Ga0500616_0331927 3300053153 Unclassified 623
148 rootH1_10302245
149 Ga0065715_10295141
150 Ga0070689_100044638
151 Ga0070688_100068501
152 Ga0070714_100030630
153 Ga0070713_100690158
154 Ga0070700_100658907
155 Ga0070681_10029684
156 Ga0070706_100908526
157 Ga0070698_101315264
158 Ga0070679_101083327
159 Ga0070696_101267642
160 Ga0068857_100102576
161 Ga0068857_100163351
162 Ga0068856_100327525
163 Ga0068859_100750418
164 Ga0068859_100959020
165 Ga0068864_100199784
166 Ga0068870_10186994
167 Ga0068863_100215507
168 Ga0075429_100204293
169 Ga0097620_100750347
170 Ga0097620_100959196
171 Ga0105240_11540329
172 Ga0105242_10722870
173 Ga0105248_10401101
174 Ga0105238_10099019
175 Ga0157374_10749042
176 Ga0157375_10907641
177 Ga0157375_11134167
178 Ga0157375_13177725
179 Ga0163163_10274024
180 Ga0163163_10289398
181 Ga0157377_10235757
182 Ga0207705_10326612
183 Ga0207707_10091024
184 Ga0207646_11148211
185 Ga0207664_10025230
186 Ga0207670_10089830
187 Ga0207711_10533487
188 Ga0207711_10624384
189 Ga0207708_10514181
190 Ga0207674_10180733
191 Ga0265337_1001030
192 Ga0265337_1002055
193 Ga0265337_1005729
194 Ga0265337_1014963
195 Ga0265337_1025585
196 Ga0265326_10005347
197 Ga0265326_10097048
198 Ga0265326_10100744
199 Ga0265326_10237694
200 Ga0265334_10035818
201 Ga0265336_10001747
202 Ga0265336_10014788
203 Ga0265338_10000036
204 Ga0265338_10000248
205 Ga0265338_10000336
206 Ga0265338_10000879
207 Ga0265338_10001440
208 Ga0265338_10001655
209 Ga0265338_10004498
210 Ga0265338_10005363
211 Ga0265338_10005601
212 Ga0265338_10040180
213 Ga0265338_10045153
214 Ga0265338_10160191
215 Ga0265338_10226999
216 Ga0265338_10390509
217 Ga0265324_10000702
218 Ga0265324_10000718
219 Ga0265324_10006414
220 Ga0265324_10078035
221 Ga0265332_10018772
222 Ga0265332_10073880
223 Ga0265320_10000809
224 Ga0265320_10007539
225 Ga0265320_10022118
226 Ga0265320_10134074
227 Ga0265320_10212192
228 Ga0265320_10280831
229 Ga0265325_10205725
230 Ga0265329_10000522
231 Ga0265339_10292419
232 Ga0265339_10328885
233 Ga0265339_10341743
234 Ga0265331_10173319
235 Ga0265331_10239427
236 Ga0265327_10010120
237 Ga0265316_10083731
238 Ga0265316_10177169
239 Ga0265316_10369866
240 Ga0265314_10000037
241 Ga0265314_10004043
242 Ga0265314_10254338
243 Ga0265314_10289842
244 Ga0265314_10316680
245 Ga0373957_0156953
246 Ga0373927_0003806
247 Ga0373927_0973960
248 Ga0373937_0350149
249 Ga0373925_0515957
250 Ga0373925_0571595
251 Ga0451577_0029894
252 Ga0451577_0141801
253 Ga0451577_0694854
254 Ga0453684_0012301
255 Ga0451576_0083398
256 Ga0495592_0000315
257 Ga0495641_0046471
258 Ga0495580_0566945
259 Ga0495664_0057763
260 Ga0495594_0295608
261 Ga0495618_0001520
262 Ga0495628_0000127
263 Ga0495628_0481670
264 Ga0495630_0030703
265 Ga0495630_0134277
266 Ga0495666_0006699
267 Ga0495652_0067844
268 Ga0495640_0189380
269 Ga0495586_0000930
270 Ga0495586_0029698
271 Ga0495621_0064161
272 Ga0495634_0037814
273 Ga0495634_0151277
274 Ga0495599_0191116
275 Ga0495647_0083100
276 Ga0495658_0264712
277 Ga0495624_0016355
278 Ga0495624_0125024
279 Ga0495674_0014682
280 Ga0495674_0098207
281 Ga0495676_0045042
282 Ga0501032_0050845
283 Ga0501033_0019563
284 Ga0501034_0375694
285 Ga0501034_0504499
286 Ga0501043_0347679
287 Ga0501047_0321212
288 Ga0501080_0022769
289 Ga0501080_0674162
290 Ga0501035_0012545
291 Ga0501035_0228594
292 Ga0501044_0014462
293 nmdc:mga09592_151886_c1
294 Ga0500616_0331927

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05130

FlgN

FlgN protein

1

151

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fup-assembly1.cif.gz_A crystal structure of a putative flagella synthesis protein flgn (pa3352) from pseudomonas aeruginosa at 1.48 a resolution 0.7378 8 121
5azp-assembly1.cif.gz_A crystal structure of a membrane protein from pseudomonas aeruginosa 0.711 3 80
4k34-assembly3.cif.gz_B crystal structures of cusc review conformational changes accompanying folding and transmembrane channel formation 0.6868 4 66
4tx5-assembly1.cif.gz_A crystal structure of smac-diablo (in space group p65) 0.6795 2 134
5lg4-assembly1.cif.gz_A crystal structure of the sec3/sso2 complex at 2.9 angstrom resolution 0.6772 5 141
ID Description Score Start End Superfamily
af_A0A1D8PFB0_58_411_1.20.1560.10 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.9456 4 71 1.20.1560.10
af_P41909_189_527_1.20.1560.10 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.8885 4 72 1.20.1560.10
af_Q4DXX9_80_397_1.20.1560.10 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.8149 2 73 1.20.1560.10
af_Q9VU45_39_160_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8111 1 131 1.20.58.70
af_Q9VU45_39_160_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.777 1 131 1.20.58.70
ID Description Score Start End GO Terms
AF-A0A562VJL0-F1-model_v4 FlgN protein 0.9789 1 135 GO:0044780
AF-A0A383D5D4-F1-model_v4 Uncharacterized protein 0.9714 4 127
AF-A0A838HSA3-F1-model_v4 Flagellar export chaperone FlgN 0.9701 5 127 GO:0044780
AF-A0A5B8AP53-F1-model_v4 deleted 0.9689 6 113
AF-A0A2W5YGZ8-F1-model_v4 Flagellar protein FlgN 0.9652 4 123 GO:0044780

Map