F198435

General Info

Members Datasets Scaffolds Average Seq Length
146 131 106 303

Family's Representative Sequence

Representative Sequence 3300046474|Ga0495605_0031063|Ga0495605_0031063_909_1916
Length 335
Sequence VAPDLSAKVAARRRSLLDIRRFCEHLNLASETPMRWKKMGLLFCPDRIHPKLTSHAANPLAVHLHEDVYRVFYSGRDTQNRSSVGYVDVDIVKRTVVYVHDKPVFEHGPEGSFYSHGVSIGNCYQAGSQRYILFMGWQYPPGGHWRGDVGRLLLGDDLSLRLDSEKPFMAADQTDPVSLSYPWVIHTPDEYRMWYGSTMTWDAGNGEMIHVIQHASSQDGHAWQRHGLAVPYVIGTAQAFSRPTVIGNASDGYRMWFSYRSGSGESYRIGYAESPDGREWELELAKTGIDVSSEGWDSEMIEYPFVFEHKGQEYMLYNGNXXXKTGFGLALRTDD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231019 Pseudomonas sp. GM67 Isolate Nodule
3 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
4 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
5 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
6 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
7 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
8 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
9 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
10 2718217882 Rhizobium sp. N741 Isolate Nodule
11 2718218009 Rhizobium sp. N561 Isolate Nodule
12 2718218363 Rhizobium sp. N113 Isolate Nodule
13 2718218366 Rhizobium sp. N621 Isolate Nodule
14 2721755514 Rhizobium sp. N6212 Isolate Nodule
15 2721755810 Rhizobium sp. N871 Isolate Nodule
16 2728369365 Rhizobium sp. N1341 Isolate Nodule
17 2738541307 Variovorax sp. GV008 Isolate Unclassified
18 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
19 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
20 2791355266 Rhizobium sp. L43 Isolate Nodule
21 2802429633 Rhizobium anhuiense J3 Isolate Nodule
22 2802429637 Rhizobium anhuiense C15 Isolate Nodule
23 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
24 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
25 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
26 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
27 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
28 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
29 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
30 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
31 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
32 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
33 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
34 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
35 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
36 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
37 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
38 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
39 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
40 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
41 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
42 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
43 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
44 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
45 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
46 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
47 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
48 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
49 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
50 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
51 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
52 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
53 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
54 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
55 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
56 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
85 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
86 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
89 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
90 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
91 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
92 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
93 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
94 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
95 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
102 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
105 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
106 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
109 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
112 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
113 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
114 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
115 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
116 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
117 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
118 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
119 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
120 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
121 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
122 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
123 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
124 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
125 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
126 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
127 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
128 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
129 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
130 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
131 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 72.6
Metatranscriptomes 0
Isolates 27.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.34
Nodule 19.18
Rhizoplane 2.05
Rhizosphere 41.78
Stem 0
Stem Tuber 0
Unclassified 11.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1298911 2162886007 Bacteria 8169
2 SwRhRL2b_contig_1317335 2162886007 Unclassified 1363
3 JGI25158J39367_1000200 3300002739 Bacteria 14248
4 JGI25159J45721_1000044 3300002987 Bacteria 60564
5 JGI25151J46595_10000935 3300003187 Bacteria 22615
6 JGI25160J50197_1000206 3300003354 Bacteria 49083
7 JGI25161J50226_1000097 3300003374 Bacteria 72031
8 Ga0055526_1001184 3300003771 Bacteria 18874
9 Ga0055524_1009675 3300003775 Bacteria 3897
10 Ga0055536_1000022 3300003781 Bacteria 198244
11 Ga0055528_1000388 3300003790 Bacteria 35799
12 Ga0055530_10002978 3300003791 Bacteria 10183
13 Ga0055531_10003227 3300003794 Bacteria 10460
14 Ga0055543_1000056 3300004625 Bacteria 103704
15 Ga0065165_1000719 3300005262 Bacteria 46606
16 Ga0065714_10067063 3300005288 Bacteria 5937
17 Ga0065714_10071255 3300005288 Plasmid 3624
18 Ga0065704_10070439 3300005289 Bacteria 24843
19 Ga0065704_10121147 3300005289 Unclassified 1761
20 Ga0070708_100104972 3300005445 Bacteria 2592
21 Ga0075364_10000897 3300006051 Bacteria 15723
22 Ga0075432_10013861 3300006058 Bacteria 2743
23 Ga0075367_10076665 3300006178 Bacteria 2018
24 Ga0075433_10093216 3300006852 Bacteria 2664
25 Ga0099826_10000016 3300006948 Bacteria 210934
26 Ga0105240_10010885 3300009093 Bacteria 12741
27 Ga0114129_10016217 3300009147 Bacteria 10601
28 Ga0123341_1001979 3300009765 Bacteria 16294
29 Ga0157373_10000368 3300013100 Bacteria 36141
30 Ga0182007_10016681 3300015262 Bacteria 2703
31 Ga0163161_10012675 3300017792 Bacteria 5855
32 Ga0209436_100008 3300025208 Bacteria 145772
33 Ga0209129_1003408 3300025258 Bacteria 6956
34 Ga0209455_1000545 3300025272 Bacteria 25849
35 Ga0209673_1000874 3300025273 Bacteria 39105
36 Ga0209673_1003206 3300025273 Bacteria 9912
37 Ga0209130_1000019 3300025284 Bacteria 381993
38 Ga0209130_1002412 3300025284 Bacteria 9421
39 Ga0209675_1001318 3300025291 Bacteria 14715
40 Ga0209676_1000012 3300025292 Bacteria 841431
41 Ga0209025_1000124 3300025294 Bacteria 201973
42 Ga0209025_1024907 3300025294 Bacteria 3070
43 Ga0209564_1001134 3300025295 Bacteria 31275
44 Ga0209758_1002407 3300025297 Bacteria 19168
45 Ga0209050_1000064 3300025298 Bacteria 314803
46 Ga0209256_1000977 3300025299 Bacteria 34337
47 Ga0207426_1000005 3300025302 Bacteria 1037188
48 Ga0209051_1001707 3300025303 Bacteria 17540
49 Ga0209257_1000010 3300025304 Bacteria 1158682
50 Ga0207695_10016823 3300025913 Bacteria 8538
51 Ga0209282_1000064 3300027666 Bacteria 91973
52 Ga0265319_1000366 3300028563 Bacteria 32675
53 Ga0265319_1000514 3300028563 Bacteria 26656
54 Ga0316182_1380361 3300030745 Bacteria 2055
55 Ga0436361_0192608 3300039447 Bacteria 1494
56 Ga0439436_0043647 3300041404 Bacteria 1279
57 Ga0439438_004554 3300041405 Bacteria 5282
58 Ga0439466_0000351 3300041411 Bacteria 17708
59 Ga0451837_1089226 3300041494 Bacteria 958
60 Ga0451843_1686261 3300041509 Bacteria 2941
61 Ga0439451_000060 3300042009 Bacteria 20604
62 Ga0439451_000322 3300042009 Bacteria 9295
63 Ga0439452_000238 3300042010 Bacteria 38069
64 Ga0439456_003666 3300042013 Bacteria 3122
65 Ga0451577_0181732 3300042876 Bacteria 1896
66 Ga0453683_0000134 3300044673 Bacteria 108503
67 Ga0453684_0005187 3300044712 Bacteria 26211
68 Ga0453684_0008948 3300044712 Bacteria 17706
69 Ga0451576_0000392 3300045051 Bacteria 101819
70 Ga0466958_0036847 3300045836 Bacteria 2929
71 Ga0495605_0031063 3300046474 Unclassified 2731
72 Ga0495585_0001860 3300046492 Bacteria 15957
73 Ga0495585_0075530 3300046492 Bacteria 1832
74 Ga0495610_0002955 3300046512 Bacteria 13707
75 Ga0495637_0000117 3300046520 Bacteria 58356
76 Ga0495648_0046482 3300046524 Unclassified 2690
77 Ga0495654_0036086 3300046530 Bacteria 2486
78 Ga0495640_0141004 3300046533 Bacteria 1554
79 Ga0495661_0086571 3300046665 Bacteria 1793
80 Ga0495588_0005158 3300046674 Bacteria 5805
81 Ga0495657_0066660 3300046675 Bacteria 2365
82 Ga0495671_0000341 3300046692 Bacteria 38904
83 Ga0495649_0039983 3300046694 Unclassified 2570
84 Ga0495649_0049996 3300046694 Bacteria 2270
85 Ga0495660_0004706 3300046810 Bacteria 8232
86 Ga0495604_0022946 3300047317 Bacteria 4980
87 Ga0495675_0003860 3300047444 Bacteria 9079
88 Ga0495673_0003192 3300047469 Bacteria 10956
89 Ga0495681_0002653 3300047470 Bacteria 12683
90 Ga0496116_0011775 3300048919 Bacteria 7202
91 Ga0496116_0025707 3300048919 Bacteria 4322
92 Ga0496121_0031424 3300048924 Unclassified 4851
93 Ga0496122_0012144 3300048925 Bacteria 8621
94 Ga0496122_0093089 3300048925 Bacteria 2046
95 Ga0496124_0004256 3300048927 Bacteria 16844
96 Ga0496124_0155504 3300048927 Bacteria 1789
97 Ga0496125_0001285 3300048928 Bacteria 37261
98 Ga0496125_0017982 3300048928 Bacteria 6719
99 Ga0495678_000192 3300049459 Bacteria 71600
100 Ga0501225_0047507 3300049705 Bacteria 1191
101 Ga0501226_000004 3300049853 Bacteria 284656
102 nmdc:mga00v17_1803_c1 3300050491 Bacteria 11097
103 nmdc:mga0a205_1312_c1 3300050515 Bacteria 20925
104 Ga0500590_003170 3300053148 Bacteria 7516
105 Ga0500622_0000092 3300053156 Bacteria 92830
106 Ga0500645_000061 3300053730 Bacteria 85703

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0005187 Ga0453684_0005187_19804_20556 249
2 3300046694 Ga0495649_0049996 Ga0495649_0049996_1458_2219 252
3 3300041494 Ga0451837_1089226 Ga0451837_1089226_86_910 266
4 3300046675 Ga0495657_0066660 Ga0495657_0066660_22_843 272
5 3300046492 Ga0495585_0075530 Ga0495585_0075530_44_865 273
6 3300046520 Ga0495637_0000117 Ga0495637_0000117_42610_43431 273
7 3300046530 Ga0495654_0036086 Ga0495654_0036086_1416_2237 273
8 3300046665 Ga0495661_0086571 Ga0495661_0086571_50_871 273
9 3300046810 Ga0495660_0004706 Ga0495660_0004706_4518_5339 273
10 3300047469 Ga0495673_0003192 Ga0495673_0003192_3710_4531 273
11 3300049459 Ga0495678_000192 Ga0495678_000192_55389_56210 273
12 3300053148 Ga0500590_003170 Ga0500590_003170_5115_5966 283
13 3300009765 Ga0123341_1001979 Ga0123341_100197916 288
14 3300006948 Ga0099826_10000016 Ga0099826_10000016104 297
15 3300027666 Ga0209282_1000064 Ga0209282_100006457 297
16 iso_pu_bacteria 2516653085 2517079362 297
17 iso_pu_bacteria 2802429633 2806049538 297
18 iso_pu_bacteria 2802429637 2806074840 297
19 iso_pu_bacteria 2838686498 2838691542 297
20 iso_pu_bacteria 2838729681 2838736554 297
21 iso_pu_bacteria 2838742623 2838749426 297
22 iso_pu_bacteria 2842156927 2842163515 297
23 iso_pu_bacteria 2842180545 2842187136 297
24 iso_pu_bacteria 2842243621 2842250427 297
25 iso_pu_bacteria 2842257432 2842264335 297
26 iso_pu_bacteria 2842271015 2842278547 297
27 iso_pu_bacteria 2844454524 2844455951 297
28 3300015262 Ga0182007_10016681 Ga0182007_100166813 298
29 3300046524 Ga0495648_0046482 Ga0495648_0046482_16_1023 298
30 3300046694 Ga0495649_0039983 Ga0495649_0039983_237_1244 298
31 3300003775 Ga0055524_1009675 Ga0055524_10096753 300
32 3300025273 Ga0209673_1000874 Ga0209673_100087419 300
33 3300046533 Ga0495640_0141004 Ga0495640_0141004_632_1537 300
34 iso_pu_bacteria 2786546517 2787434751 300
35 3300028563 Ga0265319_1000514 Ga0265319_10005146 301
36 iso_pu_bacteria 2513237103 2513710723 301
37 iso_pu_bacteria 2516653077 2517037521 301
38 iso_pu_bacteria 2517093000 2517093293 301
39 iso_pu_bacteria 2718217882 2719179961 301
40 iso_pu_bacteria 2718218009 2719730710 301
41 iso_pu_bacteria 2718218363 2721146054 301
42 iso_pu_bacteria 2718218366 2721162934 301
43 iso_pu_bacteria 2721755514 2722839104 301
44 iso_pu_bacteria 2721755810 2724043466 301
45 iso_pu_bacteria 2728369365 2730163198 301
46 iso_pu_bacteria 2765235942 2766064991 301
47 iso_pu_bacteria 2791355266 2793359756 301
48 iso_pu_bacteria 2857516855 2857522123 301
49 iso_pu_bacteria 639633055 639646676 301
50 3300003187 JGI25151J46595_10000935 JGI25151J46595_1000093511 302
51 3300003771 Ga0055526_1001184 Ga0055526_10011842 302
52 3300003781 Ga0055536_1000022 Ga0055536_100002241 302
53 3300003790 Ga0055528_1000388 Ga0055528_100038818 302
54 3300005445 Ga0070708_100104972 Ga0070708_1001049722 302
55 3300006178 Ga0075367_10076665 Ga0075367_100766652 302
56 3300025284 Ga0209130_1002412 Ga0209130_10024127 302
57 3300025292 Ga0209676_1000012 Ga0209676_1000012634 302
58 3300025294 Ga0209025_1000124 Ga0209025_100012477 302
59 3300025295 Ga0209564_1001134 Ga0209564_100113421 302
60 3300025297 Ga0209758_1002407 Ga0209758_100240713 302
61 3300025299 Ga0209256_1000977 Ga0209256_100097717 302
62 3300025303 Ga0209051_1001707 Ga0209051_100170710 302
63 3300048919 Ga0496116_0011775 Ga0496116_0011775_5709_6617 302
64 iso_pu_bacteria 2738541307 2738882500 302
65 iso_pu_bacteria 2894510363 2894511818 302
66 iso_pu_bacteria 2954767861 2954769427 302
67 3300006058 Ga0075432_10013861 Ga0075432_100138613 303
68 3300006852 Ga0075433_10093216 Ga0075433_100932164 303
69 3300009147 Ga0114129_10016217 Ga0114129_100162173 303
70 3300028563 Ga0265319_1000366 Ga0265319_100036626 303
71 3300041404 Ga0439436_0043647 Ga0439436_0043647_120_1031 303
72 3300047317 Ga0495604_0022946 Ga0495604_0022946_2034_2945 303
73 3300050515 nmdc:mga0a205_1312_c1 nmdc:mga0a205_1312_c1_11483_12406 303
74 iso_pu_bacteria 2511231019 2511342654 303
75 iso_pu_bacteria 2582581299 2585233353 303
76 iso_pu_bacteria 2599185317 2600027669 303
77 iso_pu_bacteria 2600254930 2600356622 303
78 iso_pu_bacteria 2808606377 2808931210 303
79 iso_pu_bacteria 2808606381 2808953300 303
80 iso_pu_bacteria 2825651385 2825653064 303
81 iso_pu_bacteria 2919704043 2919708597 303
82 iso_pu_bacteria 2929138655 2929143179 303
83 iso_pu_bacteria 3007511990 3007516145 303
84 3300042876 Ga0451577_0181732 Ga0451577_0181732_834_1769 304
85 3300044673 Ga0453683_0000134 Ga0453683_0000134_53233_54168 304
86 3300044712 Ga0453684_0008948 Ga0453684_0008948_3745_4680 304
87 3300045051 Ga0451576_0000392 Ga0451576_0000392_54314_55249 304
88 3300046474 Ga0495605_0031063 Ga0495605_0031063_909_1916 304
89 3300002739 JGI25158J39367_1000200 JGI25158J39367_100020015 305
90 3300002987 JGI25159J45721_1000044 JGI25159J45721_100004439 305
91 3300003354 JGI25160J50197_1000206 JGI25160J50197_100020624 305
92 3300003374 JGI25161J50226_1000097 JGI25161J50226_100009764 305
93 3300004625 Ga0055543_1000056 Ga0055543_100005639 305
94 3300005262 Ga0065165_1000719 Ga0065165_100071935 305
95 3300006051 Ga0075364_10000897 Ga0075364_1000089712 305
96 3300025208 Ga0209436_100008 Ga0209436_10000879 305
97 3300025258 Ga0209129_1003408 Ga0209129_10034085 305
98 3300025273 Ga0209673_1003206 Ga0209673_100320613 305
99 3300025284 Ga0209130_1000019 Ga0209130_1000019139 305
100 3300025294 Ga0209025_1024907 Ga0209025_10249074 305
101 3300025302 Ga0207426_1000005 Ga0207426_1000005468 305
102 3300041509 Ga0451843_1686261 Ga0451843_1686261_1092_2033 305
103 3300045836 Ga0466958_0036847 Ga0466958_0036847_1673_2590 305
104 3300048919 Ga0496116_0025707 Ga0496116_0025707_2645_3571 305
105 3300048924 Ga0496121_0031424 Ga0496121_0031424_555_1481 305
106 3300048925 Ga0496122_0012144 Ga0496122_0012144_6073_6999 305
107 3300048927 Ga0496124_0004256 Ga0496124_0004256_7951_8877 305
108 3300048927 Ga0496124_0155504 Ga0496124_0155504_85_1011 305
109 3300048928 Ga0496125_0001285 Ga0496125_0001285_7968_8894 305
110 3300050491 nmdc:mga00v17_1803_c1 nmdc:mga00v17_1803_c1_8688_9614 305
111 3300053156 Ga0500622_0000092 Ga0500622_0000092_47329_48255 305
112 3300025272 Ga0209455_1000545 Ga0209455_100054516 306
113 3300025291 Ga0209675_1001318 Ga0209675_10013189 306
114 3300030745 Ga0316182_1380361 Ga0316182_13803613 306
115 3300039447 Ga0436361_0192608 Ga0436361_0192608_231_1157 306
116 3300041405 Ga0439438_004554 Ga0439438_004554_3110_4030 306
117 3300042010 Ga0439452_000238 Ga0439452_000238_19396_20316 306
118 3300046674 Ga0495588_0005158 Ga0495588_0005158_4588_5511 306
119 3300048925 Ga0496122_0093089 Ga0496122_0093089_409_1332 306
120 3300049705 Ga0501225_0047507 Ga0501225_0047507_19_942 306
121 2162886007 SwRhRL2b_contig_1298911 SwRhRL2b_0420.00002340 307
122 2162886007 SwRhRL2b_contig_1317335 SwRhRL2b_0704.00001470 307
123 3300003791 Ga0055530_10002978 Ga0055530_100029788 307
124 3300003794 Ga0055531_10003227 Ga0055531_100032278 307
125 3300005288 Ga0065714_10067063 Ga0065714_100670633 307
126 3300005288 Ga0065714_10071255 Ga0065714_100712552 307
127 3300005289 Ga0065704_10070439 Ga0065704_100704398 307
128 3300005289 Ga0065704_10121147 Ga0065704_101211472 307
129 3300009093 Ga0105240_10010885 Ga0105240_100108859 307
130 3300013100 Ga0157373_10000368 Ga0157373_1000036824 307
131 3300017792 Ga0163161_10012675 Ga0163161_100126757 307
132 3300025298 Ga0209050_1000064 Ga0209050_1000064159 307
133 3300025304 Ga0209257_1000010 Ga0209257_1000010519 307
134 3300025913 Ga0207695_10016823 Ga0207695_100168237 307
135 3300041411 Ga0439466_0000351 Ga0439466_0000351_13822_14745 307
136 3300042009 Ga0439451_000060 Ga0439451_000060_14112_15035 307
137 3300042009 Ga0439451_000322 Ga0439451_000322_1399_2322 307
138 3300042013 Ga0439456_003666 Ga0439456_003666_1111_2034 307
139 3300046492 Ga0495585_0001860 Ga0495585_0001860_2522_3445 307
140 3300046512 Ga0495610_0002955 Ga0495610_0002955_4522_5445 307
141 3300046692 Ga0495671_0000341 Ga0495671_0000341_16518_17441 307
142 3300047444 Ga0495675_0003860 Ga0495675_0003860_916_1839 307
143 3300047470 Ga0495681_0002653 Ga0495681_0002653_5279_6202 307
144 3300048928 Ga0496125_0017982 Ga0496125_0017982_1785_2708 307
145 3300049853 Ga0501226_000004 Ga0501226_000004_264062_264988 307
146 3300053730 Ga0500645_000061 Ga0500645_000061_38122_39048 307

Structural Annotation

Top 5 Hits

ID Description Score Start End
5muj-assembly1.cif.gz_A bt0996 rgii chain b complex 0.7501 7 307
5muj-assembly1.cif.gz_A bt0996 rgii chain b complex 0.735 7 307
5ay9-assembly1.cif.gz_A crystal structure of ruminococcus albus 4-o-beta-d-mannosyl-d-glucose phosphorylase (ramp1) 0.7269 4 303
5a7v-assembly2.cif.gz_B the gh130 family of mannoside phosphorylases contains glycoside hydrolases that target beta-1,2 mannosidic linkages in candida mannan 0.7267 3 303
5a7v-assembly2.cif.gz_B the gh130 family of mannoside phosphorylases contains glycoside hydrolases that target beta-1,2 mannosidic linkages in candida mannan 0.7122 3 303
ID Description Score Start End Superfamily
af_P9WLW7_1_144_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.912 5 147 2.115.10.20
af_P9WLW7_145_299_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.9011 149 306 2.115.10.20
af_P9WLW7_1_144_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8942 5 147 2.115.10.20
af_P9WLW7_145_299_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8902 149 306 2.115.10.20
af_K7K7P2_351_492_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8192 185 303 2.115.10.20
ID Description Score Start End GO Terms
AF-A0A4Q1K3Z0-F1-model_v4 Glycosyl hydrolase family 32 N-terminal domain-containing protein 0.9806 4 305
AF-A0A833H2W3-F1-model_v4 Glycosyl hydrolase family 32 N-terminal domain-containing protein 0.9782 1 305
AF-A0A833H2W3-F1-model_v4 Glycosyl hydrolase family 32 N-terminal domain-containing protein 0.975 1 305
AF-A0A024EBX6-F1-model_v4 Glycosyl hydrolase family 32 N-terminal domain-containing protein 0.9747 56 307
AF-A0A4Q1K3Z0-F1-model_v4 Glycosyl hydrolase family 32 N-terminal domain-containing protein 0.9741 4 305

Feature Viewer

pLDDT pTM Quality
92.64 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map