F196127

General Info

Members Datasets Scaffolds Average Seq Length
145 110 132 298

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2808606439|2809194465
Length 342
Sequence SPYEPTSGQTNHMEYDSNRGTRDLNSSHELRSLGSISRSATPIVAVVGATAAGKTSLSLDLAEALDGEIINTDAMQVYRGMDIGTAKLPIAERRGIPHHLLDLLDIAEPASVADFQGLARDTIATLRKAGKTPVLVGGSALYTRAILDRFEFPGTSDEVRERLEKELEIAGEKALHDRLRALDPVAAGRIEIDNGRRVVRALEVIELTGQPFSARLPEQVYHDPASVQIGVDISREALDVRIRQRVAEMFEAGFVDEVARLLEAGLGRSRTAAKAIGYQEVAAHLAGEMTLAEAMERTAIKTRQFARRQDAWFRKDPRVVWVSYDDPSRLEKAVAAVKAVQS

Samples

Sample ID Description Type Environment
1 2643221696 Nocardioides sp. Root140 Isolate Unclassified
2 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
3 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
4 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
5 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
6 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
7 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
8 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
9 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
10 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
11 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
12 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
13 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
14 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
35 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
46 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
47 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
48 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
49 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
50 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
51 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
52 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
53 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
54 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
55 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
56 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
57 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
58 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
59 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
60 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
61 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
62 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
63 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
64 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
65 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
66 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
67 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
68 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
69 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
70 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
71 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
72 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
73 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
74 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
75 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
76 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
77 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
78 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
79 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
80 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
81 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
82 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
83 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
84 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
85 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
86 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
87 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
97 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
98 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
101 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
102 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
103 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
104 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
105 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
106 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
107 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
108 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
109 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
110 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.03
Metatranscriptomes 0
Isolates 8.97

Biome Distribution

Category Percentage (%)
Aerial Root 0.69
Bulb 0
Endosphere 8.28
Nodule 0
Rhizoplane 16.55
Rhizosphere 49.66
Stem 0
Stem Tuber 0
Unclassified 24.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1003452 3300002738 Bacteria 3310
2 Ga0055540_1000029 3300003792 Bacteria 179894
3 Ga0070683_100014346 3300005329 Bacteria 6929
4 Ga0070671_100085740 3300005355 Bacteria 2635
5 Ga0070674_100232582 3300005356 Bacteria 1439
6 Ga0070659_100014298 3300005366 Bacteria 5928
7 Ga0070667_100000252 3300005367 Bacteria 60780
8 Ga0070684_100164307 3300005535 Bacteria 2015
9 Ga0070665_100009729 3300005548 Bacteria 9720
10 Ga0068855_100133526 3300005563 Bacteria 2833
11 Ga0068863_100045946 3300005841 Bacteria 4145
12 Ga0068863_100054790 3300005841 Bacteria 3778
13 Ga0068860_100008061 3300005843 Bacteria 10498
14 Ga0075365_10002640 3300006038 Bacteria 8891
15 Ga0075365_10124615 3300006038 Bacteria 1780
16 Ga0075370_10243538 3300006353 Bacteria 1065
17 Ga0105245_10316598 3300009098 Bacteria 1536
18 Ga0105237_10009616 3300009545 Bacteria 10351
19 Ga0105239_10013448 3300010375 Bacteria 9093
20 Ga0157375_10120996 3300013308 Bacteria 2727
21 Ga0163163_10322957 3300014325 Bacteria 1597
22 Ga0157379_10554136 3300014968 Bacteria 1070
23 Ga0209646_1000098 3300025246 Bacteria 180711
24 Ga0209051_1000042 3300025303 Bacteria 308486
25 Ga0207657_10030051 3300025919 Bacteria 4936
26 Ga0207644_10034507 3300025931 Bacteria 3540
27 Ga0207690_10034490 3300025932 Bacteria 3261
28 Ga0207704_10244184 3300025938 Bacteria 1344
29 Ga0207691_10319796 3300025940 Bacteria 1331
30 Ga0207661_10378075 3300025944 Bacteria 1282
31 Ga0207641_10016744 3300026088 Bacteria 6004
32 Ga0207641_10033208 3300026088 Bacteria 4288
33 Ga0207683_10114019 3300026121 Bacteria 2421
34 Ga0268264_10000531 3300028381 Bacteria 48262
35 Ga0268264_10078682 3300028381 Bacteria 2812
36 Ga0265327_10000021 3300031251 Bacteria 417788
37 Ga0316576_10002090 3300031727 Bacteria 11235
38 Ga0439465_0035321 3300041413 Bacteria 1603
39 Ga0451853_0088215 3300041512 Bacteria 6227
40 Ga0451853_1489021 3300041512 Bacteria 2849
41 Ga0439448_0070875 3300042005 Bacteria 1161
42 Ga0439446_0015695 3300042156 Bacteria 2102
43 Ga0453683_0000002 3300044673 Bacteria 1244396
44 Ga0453683_0000257 3300044673 Bacteria 69856
45 Ga0466965_0013767 3300044683 Bacteria 3822
46 Ga0466965_0164589 3300044683 Bacteria 1164
47 Ga0466964_0068298 3300044706 Bacteria 1496
48 Ga0453684_0221175 3300044712 Bacteria 2193
49 Ga0466970_0120221 3300044765 Bacteria 1438
50 Ga0466957_0032969 3300044842 Bacteria 3105
51 Ga0466960_0003221 3300044901 Bacteria 6258
52 Ga0466960_0116103 3300044901 Bacteria 1396
53 Ga0451576_0003421 3300045051 Bacteria 21823
54 Ga0466967_0040735 3300045976 Bacteria 4000
55 Ga0495606_0008137 3300046507 Bacteria 9186
56 Ga0495668_0000123 3300046616 Bacteria 115173
57 Ga0495683_0002112 3300047323 Bacteria 12288
58 Ga0496100_0000025 3300048903 Bacteria 115919
59 Ga0496101_0000068 3300048904 Bacteria 120985
60 Ga0496102_0000102 3300048905 Bacteria 122251
61 Ga0496102_0002685 3300048905 Bacteria 15130
62 Ga0496102_0020047 3300048905 Bacteria 5901
63 Ga0496103_0000090 3300048906 Bacteria 101941
64 Ga0496103_0002252 3300048906 Bacteria 12214
65 Ga0496103_0025621 3300048906 Bacteria 3566
66 Ga0496104_0276778 3300048907 Bacteria 1591
67 Ga0496105_0275345 3300048908 Bacteria 1358
68 Ga0496106_0029047 3300048909 Bacteria 4120
69 Ga0496107_0000758 3300048910 Bacteria 18590
70 Ga0496108_0036955 3300048911 Bacteria 4065
71 Ga0496109_0000625 3300048912 Bacteria 29475
72 Ga0496109_0023870 3300048912 Bacteria 5429
73 Ga0496109_0320600 3300048912 Bacteria 1462
74 Ga0496110_0022523 3300048913 Bacteria 5350
75 Ga0496110_0035851 3300048913 Bacteria 4306
76 Ga0496111_0020996 3300048914 Bacteria 4553
77 Ga0496111_0030882 3300048914 Bacteria 3812
78 Ga0496111_0261682 3300048914 Bacteria 1284
79 Ga0496113_0147188 3300048916 Bacteria 1856
80 Ga0496114_0002423 3300048917 Bacteria 14231
81 Ga0496114_0255383 3300048917 Bacteria 1543
82 Ga0496116_0000364 3300048919 Bacteria 69617
83 Ga0496116_0001540 3300048919 Bacteria 25540
84 Ga0496117_0000148 3300048920 Bacteria 149369
85 Ga0496117_0025368 3300048920 Bacteria 4663
86 Ga0496118_0003928 3300048921 Bacteria 18193
87 Ga0496118_0004456 3300048921 Bacteria 16601
88 Ga0496119_0000525 3300048922 Bacteria 52134
89 Ga0496119_0001475 3300048922 Bacteria 28166
90 Ga0496120_0003111 3300048923 Bacteria 15590
91 Ga0496121_0000023 3300048924 Bacteria 463448
92 Ga0496121_0011880 3300048924 Bacteria 9589
93 Ga0496122_0000038 3300048925 Bacteria 295624
94 Ga0496122_0070542 3300048925 Bacteria 2496
95 Ga0496123_0009855 3300048926 Bacteria 8532
96 Ga0496124_0000014 3300048927 Bacteria 463448
97 Ga0496124_0095076 3300048927 Bacteria 2422
98 Ga0496125_0000020 3300048928 Bacteria 463448
99 Ga0496125_0044486 3300048928 Bacteria 3754
100 Ga0496126_0000023 3300048929 Bacteria 463448
101 Ga0496126_0000355 3300048929 Bacteria 95787
102 Ga0496126_0026125 3300048929 Bacteria 5604
103 Ga0501036_0023340 3300049572 Bacteria 5210
104 Ga0501037_0116861 3300049573 Bacteria 1919
105 Ga0501039_0028823 3300049575 Bacteria 4275
106 Ga0501039_0032052 3300049575 Bacteria 4051
107 Ga0501039_0250640 3300049575 Bacteria 1392
108 Ga0501041_0085892 3300049577 Bacteria 1941
109 Ga0501042_0063236 3300049578 Bacteria 2645
110 Ga0501046_0003442 3300049580 Bacteria 14522
111 Ga0501047_0052668 3300049581 Bacteria 3934
112 Ga0501048_0010070 3300049582 Bacteria 7070
113 Ga0501067_0016954 3300049583 Bacteria 4024
114 Ga0501067_0027490 3300049583 Bacteria 3152
115 Ga0501067_0049260 3300049583 Bacteria 2335
116 Ga0501068_0016265 3300049584 Bacteria 4288
117 Ga0501069_0050209 3300049585 Bacteria 2319
118 Ga0501069_0086518 3300049585 Bacteria 1769
119 Ga0501070_0044011 3300049586 Bacteria 3715
120 Ga0501070_0086615 3300049586 Bacteria 2593
121 Ga0501070_0421223 3300049586 Bacteria 1078
122 Ga0501073_0000024 3300049589 Bacteria 128851
123 Ga0501076_0080057 3300049592 Bacteria 2622
124 Ga0501035_0165957 3300049822 Bacteria 1909
125 nmdc:mga00v17_85486_c1 3300050491 Bacteria 1975
126 nmdc:mga0yw44_281964_c1 3300050492 Bacteria 1111
127 Ga0500644_0000003 3300053088 Bacteria 199121
128 Ga0500556_0001496 3300053104 Bacteria 9697
129 Ga0500559_0000496 3300053136 Bacteria 27644
130 Ga0500616_0006525 3300053153 Bacteria 7626
131 Ga0500620_027200 3300053155 Bacteria 1778
132 Ga0530510_0208695 3300061734 Bacteria 1451

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003792 Ga0055540_1000029 Ga0055540_100002923 251
2 3300005367 Ga0070667_100000252 Ga0070667_1000002528 251
3 3300025303 Ga0209051_1000042 Ga0209051_1000042169 251
4 3300042005 Ga0439448_0070875 Ga0439448_0070875_204_1118 251
5 3300044683 Ga0466965_0164589 Ga0466965_0164589_34_957 251
6 3300044712 Ga0453684_0221175 Ga0453684_0221175_656_1627 251
7 3300048903 Ga0496100_0000025 Ga0496100_0000025_38016_38930 251
8 3300048904 Ga0496101_0000068 Ga0496101_0000068_34087_35001 251
9 3300048905 Ga0496102_0002685 Ga0496102_0002685_8550_9464 251
10 3300048906 Ga0496103_0002252 Ga0496103_0002252_1144_2058 251
11 3300048910 Ga0496107_0000758 Ga0496107_0000758_2208_3122 251
12 3300048911 Ga0496108_0036955 Ga0496108_0036955_1619_2533 251
13 3300048912 Ga0496109_0000625 Ga0496109_0000625_23420_24334 251
14 3300048913 Ga0496110_0022523 Ga0496110_0022523_2298_3212 251
15 3300048914 Ga0496111_0030882 Ga0496111_0030882_273_1187 251
16 3300048917 Ga0496114_0002423 Ga0496114_0002423_7025_7939 251
17 3300048919 Ga0496116_0001540 Ga0496116_0001540_16332_17246 251
18 3300048920 Ga0496117_0025368 Ga0496117_0025368_2606_3520 251
19 3300048921 Ga0496118_0003928 Ga0496118_0003928_8550_9464 251
20 3300048922 Ga0496119_0001475 Ga0496119_0001475_9353_10267 251
21 3300048924 Ga0496121_0000023 Ga0496121_0000023_76700_77614 251
22 3300048925 Ga0496122_0000038 Ga0496122_0000038_76700_77614 251
23 3300048926 Ga0496123_0009855 Ga0496123_0009855_7600_8514 251
24 3300048927 Ga0496124_0000014 Ga0496124_0000014_76700_77614 251
25 3300048928 Ga0496125_0000020 Ga0496125_0000020_385835_386749 251
26 3300048929 Ga0496126_0000023 Ga0496126_0000023_76700_77614 251
27 3300049586 Ga0501070_0421223 Ga0501070_0421223_63_1010 251
28 3300044673 Ga0453683_0000002 Ga0453683_0000002_40689_41660 252
29 3300045051 Ga0451576_0003421 Ga0451576_0003421_17807_18778 252
30 3300009545 Ga0105237_10009616 Ga0105237_100096168 254
31 3300010375 Ga0105239_10013448 Ga0105239_100134485 254
32 3300049583 Ga0501067_0016954 Ga0501067_0016954_2413_3393 255
33 3300049584 Ga0501068_0016265 Ga0501068_0016265_351_1331 255
34 3300049585 Ga0501069_0050209 Ga0501069_0050209_1323_2303 255
35 3300005329 Ga0070683_100014346 Ga0070683_1000143466 256
36 3300044673 Ga0453683_0000257 Ga0453683_0000257_63266_64219 257
37 3300013308 Ga0157375_10120996 Ga0157375_101209962 258
38 3300014325 Ga0163163_10322957 Ga0163163_103229572 258
39 3300025944 Ga0207661_10378075 Ga0207661_103780751 258
40 3300044683 Ga0466965_0013767 Ga0466965_0013767_2791_3699 258
41 3300044706 Ga0466964_0068298 Ga0466964_0068298_583_1476 260
42 3300048912 Ga0496109_0320600 Ga0496109_0320600_295_1227 260
43 3300041413 Ga0439465_0035321 Ga0439465_0035321_684_1544 262
44 3300053155 Ga0500620_027200 Ga0500620_027200_690_1622 262
45 3300050492 nmdc:mga0yw44_281964_c1 nmdc:mga0yw44_281964_c1_62_1033 264
46 3300049586 Ga0501070_0044011 Ga0501070_0044011_94_1011 265
47 iso_pu_bacteria 2891968417 2891973075 265
48 3300005535 Ga0070684_100164307 Ga0070684_1001643072 267
49 3300045976 Ga0466967_0040735 Ga0466967_0040735_754_1677 269
50 3300009098 Ga0105245_10316598 Ga0105245_103165982 270
51 3300044901 Ga0466960_0116103 Ga0466960_0116103_325_1284 270
52 iso_pu_bacteria 2738541264 2738666724 271
53 iso_pu_bacteria 2738541356 2739145568 271
54 3300006353 Ga0075370_10243538 Ga0075370_102435382 272
55 3300042156 Ga0439446_0015695 Ga0439446_0015695_61_951 272
56 3300049572 Ga0501036_0023340 Ga0501036_0023340_3328_4227 272
57 3300049573 Ga0501037_0116861 Ga0501037_0116861_37_936 272
58 3300049575 Ga0501039_0028823 Ga0501039_0028823_3301_4200 272
59 3300049578 Ga0501042_0063236 Ga0501042_0063236_1136_2035 272
60 3300049580 Ga0501046_0003442 Ga0501046_0003442_301_1200 272
61 3300049581 Ga0501047_0052668 Ga0501047_0052668_301_1200 272
62 3300049582 Ga0501048_0010070 Ga0501048_0010070_3650_4549 272
63 3300049586 Ga0501070_0086615 Ga0501070_0086615_300_1199 272
64 3300049822 Ga0501035_0165957 Ga0501035_0165957_710_1609 272
65 iso_pu_bacteria 2902792274 2902798624 272
66 iso_pu_bacteria 2939582691 2939587517 272
67 3300005356 Ga0070674_100232582 Ga0070674_1002325822 273
68 3300041512 Ga0451853_1489021 Ga0451853_1489021_596_1498 273
69 iso_pu_bacteria 2842888712 2842891407 274
70 iso_pu_bacteria 2902810491 2902815337 275
71 3300005355 Ga0070671_100085740 Ga0070671_1000857403 276
72 3300005548 Ga0070665_100009729 Ga0070665_1000097294 276
73 3300005841 Ga0068863_100045946 Ga0068863_1000459462 276
74 3300005841 Ga0068863_100054790 Ga0068863_1000547902 276
75 3300005843 Ga0068860_100008061 Ga0068860_10000806110 276
76 3300014968 Ga0157379_10554136 Ga0157379_105541362 276
77 3300025931 Ga0207644_10034507 Ga0207644_100345072 276
78 3300026088 Ga0207641_10016744 Ga0207641_100167444 276
79 3300026088 Ga0207641_10033208 Ga0207641_100332084 276
80 3300028381 Ga0268264_10078682 Ga0268264_100786822 276
81 3300048905 Ga0496102_0000102 Ga0496102_0000102_81741_82640 276
82 3300048906 Ga0496103_0000090 Ga0496103_0000090_61150_62049 276
83 3300048907 Ga0496104_0276778 Ga0496104_0276778_619_1518 276
84 3300048914 Ga0496111_0261682 Ga0496111_0261682_12_911 276
85 3300048919 Ga0496116_0000364 Ga0496116_0000364_29151_30050 276
86 3300048920 Ga0496117_0000148 Ga0496117_0000148_98729_99628 276
87 3300048921 Ga0496118_0004456 Ga0496118_0004456_5666_6565 276
88 3300048922 Ga0496119_0000525 Ga0496119_0000525_25891_26790 276
89 3300048923 Ga0496120_0003111 Ga0496120_0003111_12257_13156 276
90 3300048924 Ga0496121_0011880 Ga0496121_0011880_7043_7942 276
91 3300048925 Ga0496122_0070542 Ga0496122_0070542_92_991 276
92 3300048927 Ga0496124_0095076 Ga0496124_0095076_135_1034 276
93 3300048929 Ga0496126_0000355 Ga0496126_0000355_5665_6564 276
94 3300049575 Ga0501039_0032052 Ga0501039_0032052_182_1093 276
95 3300049575 Ga0501039_0250640 Ga0501039_0250640_30_938 276
96 3300049577 Ga0501041_0085892 Ga0501041_0085892_945_1874 276
97 3300049592 Ga0501076_0080057 Ga0501076_0080057_211_1122 276
98 iso_pu_bacteria 2643221696 2644533657 276
99 iso_pu_bacteria 2990256926 2990259580 276
100 3300006038 Ga0075365_10002640 Ga0075365_100026402 277
101 3300031251 Ga0265327_10000021 Ga0265327_1000002119 277
102 3300041512 Ga0451853_0088215 Ga0451853_0088215_3818_4759 277
103 3300044765 Ga0466970_0120221 Ga0466970_0120221_220_1167 277
104 3300044842 Ga0466957_0032969 Ga0466957_0032969_851_1765 277
105 3300046507 Ga0495606_0008137 Ga0495606_0008137_1890_2813 277
106 3300046616 Ga0495668_0000123 Ga0495668_0000123_18485_19420 277
107 3300047323 Ga0495683_0002112 Ga0495683_0002112_10535_11467 277
108 3300049583 Ga0501067_0049260 Ga0501067_0049260_371_1291 277
109 3300050491 nmdc:mga00v17_85486_c1 nmdc:mga00v17_85486_c1_312_1226 277
110 3300053088 Ga0500644_0000003 Ga0500644_0000003_149405_150319 277
111 3300053136 Ga0500559_0000496 Ga0500559_0000496_11281_12195 277
112 3300053153 Ga0500616_0006525 Ga0500616_0006525_2782_3735 277
113 iso_pu_bacteria 2773857762 2774394691 277
114 iso_pu_bacteria 2811994878 2812349214 277
115 iso_pu_bacteria 2855386786 2855388353 277
116 3300005366 Ga0070659_100014298 Ga0070659_1000142984 278
117 3300005563 Ga0068855_100133526 Ga0068855_1001335262 278
118 3300006038 Ga0075365_10124615 Ga0075365_101246152 278
119 3300025919 Ga0207657_10030051 Ga0207657_100300512 278
120 3300025932 Ga0207690_10034490 Ga0207690_100344903 278
121 3300025938 Ga0207704_10244184 Ga0207704_102441842 278
122 3300025940 Ga0207691_10319796 Ga0207691_103197962 278
123 3300028381 Ga0268264_10000531 Ga0268264_1000053131 278
124 3300031727 Ga0316576_10002090 Ga0316576_1000209011 278
125 3300044901 Ga0466960_0003221 Ga0466960_0003221_3672_4601 278
126 3300048905 Ga0496102_0020047 Ga0496102_0020047_2790_3752 278
127 3300048906 Ga0496103_0025621 Ga0496103_0025621_978_1940 278
128 3300048908 Ga0496105_0275345 Ga0496105_0275345_308_1270 278
129 3300048909 Ga0496106_0029047 Ga0496106_0029047_2555_3517 278
130 3300048912 Ga0496109_0023870 Ga0496109_0023870_1015_1977 278
131 3300048913 Ga0496110_0035851 Ga0496110_0035851_2910_3872 278
132 3300048914 Ga0496111_0020996 Ga0496111_0020996_1527_2489 278
133 3300048916 Ga0496113_0147188 Ga0496113_0147188_803_1765 278
134 3300048917 Ga0496114_0255383 Ga0496114_0255383_47_1009 278
135 3300048929 Ga0496126_0026125 Ga0496126_0026125_4078_5004 278
136 3300049583 Ga0501067_0027490 Ga0501067_0027490_1853_2815 278
137 3300049585 Ga0501069_0086518 Ga0501069_0086518_165_1127 278
138 3300053104 Ga0500556_0001496 Ga0500556_0001496_669_1595 278
139 3300061734 Ga0530510_0208695 Ga0530510_0208695_133_1095 278
140 iso_pu_bacteria 2808606439 2809194465 278
141 3300026121 Ga0207683_10114019 Ga0207683_101140192 280
142 3300049589 Ga0501073_0000024 Ga0501073_0000024_39584_40519 280
143 3300002738 JGI25154J39366_1003452 JGI25154J39366_10034524 285
144 3300025246 Ga0209646_1000098 Ga0209646_100009849 285
145 3300048928 Ga0496125_0044486 Ga0496125_0044486_1259_2170 285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01715

IPPT

IPP transferase

76

316

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zm5-assembly1.cif.gz_A crystal structure of trna modification enzyme miaa in the complex with trna(phe) 0.7897 4 273
3eph-assembly1.cif.gz_A crystallographic snapshots of eukaryotic dimethylallyltransferase acting on trna: insight into trna recognition and reaction mechanism 0.78 4 263
2qgn-assembly1.cif.gz_A crystal structure of trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41. 0.7487 4 273
2zm5-assembly1.cif.gz_A crystal structure of trna modification enzyme miaa in the complex with trna(phe) 0.7486 4 273
3crr-assembly1.cif.gz_A structure of trna dimethylallyltransferase: rna modification through a channel 0.7143 2 282
ID Description Score Start End Superfamily
af_P9WJW1_115_180_1.10.20.140 Mainly Alpha;Orthogonal Bundle;Histone, subunit A; 0.9523 120 177 1.10.20.140
3d3qB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9274 4 120 3.40.50.300
3a8tA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9234 3 119 3.40.50.300
3exaA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9116 5 114 3.40.50.300
af_A0A0P0X3E8_17_159_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8513 5 203 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A329K4F9-F1-model_v4 tRNA (Adenosine(37)-N6)-dimethylallyltransferase MiaA 0.9786 5 125 GO:0005524
GO:0006400
GO:0052381
AF-A0A7K2VET2-F1-model_v4 tRNA (Adenosine(37)-N6)-dimethylallyltransferase MiaA 0.9686 1 121 GO:0005524
GO:0006400
GO:0052381
AF-A0A329K4F9-F1-model_v4 tRNA (Adenosine(37)-N6)-dimethylallyltransferase MiaA 0.9553 5 125 GO:0005524
GO:0006400
GO:0052381
AF-A0A3D0N069-F1-model_v4 tRNA (Adenosine(37)-N6)-dimethylallyltransferase MiaA 0.9409 4 110 GO:0005524
GO:0006400
GO:0052381
AF-A0A6L6EAF2-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) 0.9347 5 172 GO:0005524
GO:0006400
GO:0052381

Feature Viewer

pLDDT pTM Quality
91.36 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map