F195879

General Info

Members Datasets Scaffolds Average Seq Length
145 113 290 132

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0044143|Ga0501040_0044143_865_1338
Length 157
Sequence MSGRFLLDTNIVIAIFATEASVHAKLVSTTEVFVPCIVLGELYYGAYKSSRVTENIAKISQFAATSAVLASDAATAQVYGEIKNGLRAKGRPIPENDIWIAAITMQYNLTLVTRDSHFGEVDGLVIESWLHKTAPNKRVQRSCESKRPMAAKRHAAR

Samples

Sample ID Description Type Environment
1 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
69 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
70 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
71 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
73 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
74 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
75 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
79 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
80 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
81 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
84 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
91 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
92 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
93 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
94 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
101 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
102 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
105 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
106 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
107 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
108 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
109 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
110 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
111 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
112 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
113 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.93
Metatranscriptomes 0.69
Isolates 1.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.69
Rhizosphere 94.48
Stem 0
Stem Tuber 0
Unclassified 31.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501040_0044143 3300049576 Bacteria 3039
2 LJQas_1027643 3300000549 Unclassified 662
3 JGI25406J46586_10042288 3300003203 Bacteria 1596
4 rootH1_10067849 3300003323 Unclassified 1411
5 Ga0070658_10098925 3300005327 Bacteria 2410
6 Ga0070683_100009202 3300005329 Bacteria 8435
7 Ga0070683_102409828 3300005329 Bacteria 504
8 Ga0068868_100114032 3300005338 Unclassified 2198
9 Ga0070671_100063983 3300005355 Bacteria 3064
10 Ga0070671_100283209 3300005355 Bacteria 1410
11 Ga0070667_100032295 3300005367 Unclassified 4366
12 Ga0070667_100601406 3300005367 Unclassified 1013
13 Ga0070667_100791033 3300005367 Bacteria 880
14 Ga0070708_100110427 3300005445 Bacteria 2527
15 Ga0070706_100627141 3300005467 Unclassified 998
16 Ga0070698_100084913 3300005471 Bacteria 3153
17 Ga0070699_101604253 3300005518 Unclassified 596
18 Ga0070684_100141419 3300005535 Unclassified 2176
19 Ga0070686_100373519 3300005544 Unclassified 1077
20 Ga0068855_100026006 3300005563 Bacteria 7001
21 Ga0068856_100227529 3300005614 Bacteria 1880
22 Ga0068852_101174413 3300005616 Unclassified 788
23 Ga0068859_100400444 3300005617 Unclassified 1468
24 Ga0068864_100015460 3300005618 Bacteria 6346
25 Ga0068863_100137105 3300005841 Bacteria 2338
26 Ga0068863_100657242 3300005841 Bacteria 1040
27 Ga0068858_100310589 3300005842 Unclassified 1505
28 Ga0068858_101928447 3300005842 Bacteria 584
29 Ga0081455_10002957 3300005937 Bacteria 19867
30 Ga0081538_10049251 3300005981 Bacteria 2557
31 Ga0081539_10011673 3300005985 Bacteria 6907
32 Ga0081539_10014405 3300005985 Bacteria 5851
33 Ga0070717_10328632 3300006028 Unclassified 1363
34 Ga0070716_100924253 3300006173 Unclassified 685
35 Ga0097621_102210514 3300006237 Unclassified 526
36 Ga0075428_100882130 3300006844 Unclassified 949
37 Ga0075434_101805939 3300006871 Unclassified 618
38 Ga0097620_100400459 3300006931 Bacteria 1468
39 Ga0105240_10008930 3300009093 Bacteria 14249
40 Ga0105245_11119219 3300009098 Unclassified 834
41 Ga0105245_11208600 3300009098 Unclassified 804
42 Ga0114129_10500320 3300009147 Unclassified 1587
43 Ga0105241_10594222 3300009174 Bacteria 999
44 Ga0105241_10634029 3300009174 Bacteria 969
45 Ga0105242_10093880 3300009176 Unclassified 2530
46 Ga0105248_10512392 3300009177 Bacteria 1353
47 Ga0105237_10298858 3300009545 Bacteria 1613
48 Ga0105237_10412981 3300009545 Bacteria 1355
49 Ga0105238_10404972 3300009551 Unclassified 1358
50 Ga0105249_10709538 3300009553 Unclassified 1066
51 Ga0105249_11056001 3300009553 Unclassified 882
52 Ga0105246_11164440 3300011119 Unclassified 708
53 Ga0157370_10003369 3300013104 Bacteria 18809
54 Ga0157370_10871689 3300013104 Bacteria 818
55 Ga0157369_10102375 3300013105 Unclassified 3052
56 Ga0163162_10070634 3300013306 Unclassified 3543
57 Ga0157372_10273042 3300013307 Bacteria 1965
58 Ga0157372_10426652 3300013307 Bacteria 1545
59 Ga0157372_11128670 3300013307 Unclassified 907
60 Ga0157375_10011394 3300013308 Bacteria 7849
61 Ga0163163_10000755 3300014325 Bacteria 27525
62 Ga0163163_11333880 3300014325 Unclassified 779
63 Ga0157379_10102806 3300014968 Unclassified 2564
64 Ga0182006_1000370 3300015261 Bacteria 37249
65 Ga0182006_1087367 3300015261 Bacteria 1127
66 Ga0163161_10404525 3300017792 Bacteria 1095
67 Ga0207705_10078258 3300025909 Bacteria 2406
68 Ga0207695_10057605 3300025913 Unclassified 4036
69 Ga0207695_11519292 3300025913 Bacteria 550
70 Ga0207671_10339863 3300025914 Bacteria 1189
71 Ga0207671_10397209 3300025914 Unclassified 1096
72 Ga0207646_10657398 3300025922 Unclassified 939
73 Ga0207694_10571444 3300025924 Bacteria 950
74 Ga0207687_10418698 3300025927 Bacteria 1105
75 Ga0207644_10057378 3300025931 Bacteria 2811
76 Ga0207686_10063603 3300025934 Unclassified 2347
77 Ga0207711_10796692 3300025941 Bacteria 880
78 Ga0207661_10006276 3300025944 Bacteria 8408
79 Ga0207712_10552190 3300025961 Unclassified 991
80 Ga0207658_10370327 3300025986 Unclassified 1252
81 Ga0207658_10741142 3300025986 Bacteria 889
82 Ga0207677_10190799 3300026023 Unclassified 1621
83 Ga0207703_11453415 3300026035 Unclassified 660
84 Ga0207708_10121719 3300026075 Bacteria 2033
85 Ga0207641_10014899 3300026088 Bacteria 6375
86 Ga0209588_1106317 3300027671 Unclassified 902
87 Ga0316183_1043757 3300030742 Bacteria 18175
88 Ga0316181_1128937 3300030744 Bacteria 19479
89 Ga0316181_1185701 3300030744 Bacteria 2183
90 Ga0316182_1225663 3300030745 Bacteria 2308
91 Ga0265760_10018262 3300031090 Bacteria 2018
92 Ga0265327_10000142 3300031251 Bacteria 157436
93 Ga0265316_10211640 3300031344 Bacteria 1433
94 Ga0307508_10012918 3300031616 Bacteria 7636
95 Ga0265342_10201113 3300031712 Bacteria 1082
96 Ga0307409_100258652 3300031995 Bacteria 1596
97 Ga0307415_100467229 3300032126 Bacteria 1095
98 Ga0316582_0433605 3300036647 Bacteria 906
99 Ga0316582_1163982 3300036647 Unclassified 525
100 Ga0436364_0697190 3300037853 Unclassified 653
101 Ga0400484_39965 3300038725 Bacteria 3234
102 Ga0400489_39620 3300039093 Bacteria 2030
103 Ga0436365_1415374 3300039437 Bacteria 758
104 Ga0453683_0236948 3300044673 Bacteria 1162
105 Ga0466965_0015396 3300044683 Bacteria 3634
106 Ga0466961_0468066 3300044693 Bacteria 762
107 Ga0466964_0011030 3300044706 Bacteria 3414
108 Ga0466964_0128544 3300044706 Bacteria 1151
109 Ga0453684_0001015 3300044712 Bacteria 90419
110 Ga0453684_0001492 3300044712 Bacteria 66005
111 Ga0453684_0004505 3300044712 Bacteria 29272
112 Ga0453684_0008550 3300044712 Bacteria 18270
113 Ga0453684_0155409 3300044712 Bacteria 2713
114 Ga0466959_0015876 3300045049 Bacteria 5495
115 Ga0466967_0029908 3300045976 Bacteria 4565
116 Ga0495661_0000189 3300046665 Bacteria 71154
117 Ga0495687_013691 3300047443 Bacteria 4215
118 Ga0496114_0000005 3300048917 Bacteria 564262
119 Ga0496119_0342779 3300048922 Bacteria 726
120 Ga0501032_0000825 3300049569 Bacteria 25213
121 Ga0501036_0376927 3300049572 Bacteria 1184
122 Ga0501039_0056679 3300049575 Bacteria 3035
123 Ga0501040_0234588 3300049576 Bacteria 1307
124 Ga0501041_0185446 3300049577 Bacteria 1303
125 Ga0501042_0361801 3300049578 Bacteria 1050
126 Ga0501048_0512496 3300049582 Bacteria 860
127 Ga0501075_1534463 3300049591 Unclassified 504
128 Ga0501076_0387301 3300049592 Bacteria 1149
129 Ga0501077_0037931 3300049593 Bacteria 3068
130 Ga0501077_0241535 3300049593 Bacteria 1148
131 Ga0501035_0373208 3300049822 Bacteria 1191
132 Ga0501035_1163640 3300049822 Bacteria 600
133 Ga0501045_0100343 3300049824 Bacteria 2143
134 Ga0501045_0199782 3300049824 Bacteria 1490
135 nmdc:mga05p37_1114014_c1 3300050507 Unclassified 825
136 nmdc:mga05p37_448379_c1 3300050507 Unclassified 1494
137 nmdc:mga0qj67_203800_c1 3300050509 Bacteria 1607
138 nmdc:mga06r32_1113982_c1 3300050510 Unclassified 738
139 nmdc:mga0n895_1582804_c1 3300050512 Unclassified 620
140 Ga0501084_0102162 3300054114 Bacteria 2408
141 Ga0501084_0223532 3300054114 Bacteria 1589
142 Ga0501082_0211121 3300060353 Bacteria 1689
143 Ga0530510_0535050 3300061734 Bacteria 889
144 2849284700 2849281842 Bacteria 6065644
145 2954017538 2954016120 Bacteria 6446024
146 Ga0501040_0044143
147 LJQas_1027643
148 JGI25406J46586_10042288
149 rootH1_10067849
150 Ga0070658_10098925
151 Ga0070683_100009202
152 Ga0070683_102409828
153 Ga0068868_100114032
154 Ga0070671_100063983
155 Ga0070671_100283209
156 Ga0070667_100032295
157 Ga0070667_100601406
158 Ga0070667_100791033
159 Ga0070708_100110427
160 Ga0070706_100627141
161 Ga0070698_100084913
162 Ga0070699_101604253
163 Ga0070684_100141419
164 Ga0070686_100373519
165 Ga0068855_100026006
166 Ga0068856_100227529
167 Ga0068852_101174413
168 Ga0068859_100400444
169 Ga0068864_100015460
170 Ga0068863_100137105
171 Ga0068863_100657242
172 Ga0068858_100310589
173 Ga0068858_101928447
174 Ga0081455_10002957
175 Ga0081538_10049251
176 Ga0081539_10011673
177 Ga0081539_10014405
178 Ga0070717_10328632
179 Ga0070716_100924253
180 Ga0097621_102210514
181 Ga0075428_100882130
182 Ga0075434_101805939
183 Ga0097620_100400459
184 Ga0105240_10008930
185 Ga0105245_11119219
186 Ga0105245_11208600
187 Ga0114129_10500320
188 Ga0105241_10594222
189 Ga0105241_10634029
190 Ga0105242_10093880
191 Ga0105248_10512392
192 Ga0105237_10298858
193 Ga0105237_10412981
194 Ga0105238_10404972
195 Ga0105249_10709538
196 Ga0105249_11056001
197 Ga0105246_11164440
198 Ga0157370_10003369
199 Ga0157370_10871689
200 Ga0157369_10102375
201 Ga0163162_10070634
202 Ga0157372_10273042
203 Ga0157372_10426652
204 Ga0157372_11128670
205 Ga0157375_10011394
206 Ga0163163_10000755
207 Ga0163163_11333880
208 Ga0157379_10102806
209 Ga0182006_1000370
210 Ga0182006_1087367
211 Ga0163161_10404525
212 Ga0207705_10078258
213 Ga0207695_10057605
214 Ga0207695_11519292
215 Ga0207671_10339863
216 Ga0207671_10397209
217 Ga0207646_10657398
218 Ga0207694_10571444
219 Ga0207687_10418698
220 Ga0207644_10057378
221 Ga0207686_10063603
222 Ga0207711_10796692
223 Ga0207661_10006276
224 Ga0207712_10552190
225 Ga0207658_10370327
226 Ga0207658_10741142
227 Ga0207677_10190799
228 Ga0207703_11453415
229 Ga0207708_10121719
230 Ga0207641_10014899
231 Ga0209588_1106317
232 Ga0316183_1043757
233 Ga0316181_1128937
234 Ga0316181_1185701
235 Ga0316182_1225663
236 Ga0265760_10018262
237 Ga0265327_10000142
238 Ga0265316_10211640
239 Ga0307508_10012918
240 Ga0265342_10201113
241 Ga0307409_100258652
242 Ga0307415_100467229
243 Ga0316582_0433605
244 Ga0316582_1163982
245 Ga0436364_0697190
246 Ga0400484_39965
247 Ga0400489_39620
248 Ga0436365_1415374
249 Ga0453683_0236948
250 Ga0466965_0015396
251 Ga0466961_0468066
252 Ga0466964_0011030
253 Ga0466964_0128544
254 Ga0453684_0001015
255 Ga0453684_0001492
256 Ga0453684_0004505
257 Ga0453684_0008550
258 Ga0453684_0155409
259 Ga0466959_0015876
260 Ga0466967_0029908
261 Ga0495661_0000189
262 Ga0495687_013691
263 Ga0496114_0000005
264 Ga0496119_0342779
265 Ga0501032_0000825
266 Ga0501036_0376927
267 Ga0501039_0056679
268 Ga0501040_0234588
269 Ga0501041_0185446
270 Ga0501042_0361801
271 Ga0501048_0512496
272 Ga0501075_1534463
273 Ga0501076_0387301
274 Ga0501077_0037931
275 Ga0501077_0241535
276 Ga0501035_0373208
277 Ga0501035_1163640
278 Ga0501045_0100343
279 Ga0501045_0199782
280 nmdc:mga05p37_1114014_c1
281 nmdc:mga05p37_448379_c1
282 nmdc:mga0qj67_203800_c1
283 nmdc:mga06r32_1113982_c1
284 nmdc:mga0n895_1582804_c1
285 Ga0501084_0102162
286 Ga0501084_0223532
287 Ga0501082_0211121
288 Ga0530510_0535050
289 2849284700
290 2954017538

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

5

124

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ecy-assembly1.cif.gz_H structure of the shigella flexneri vapc mutant d98n crystal form 2 0.9598 13 138
5ecw-assembly1.cif.gz_B structure of the shigella flexneri vapc mutant d7a 0.9456 13 138
6sd6-assembly1.cif.gz_C structure of vapbc from shigella sonnei 0.9396 13 138
5ed0-assembly2.cif.gz_B structure of the shigella flexneri vapc mutant d7n 0.9318 13 138
3tnd-assembly1.cif.gz_G crystal structure of shigella flexneri vapbc toxin-antitoxin complex 0.9313 13 136
ID Description Score Start End Superfamily
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9456 13 138 3.40.50.1010
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.916 13 138 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9068 13 138 3.40.50.1010
6nklA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8965 13 138 3.40.50.1010
3b9pA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8948 84 114 1.10.8.60
ID Description Score Start End GO Terms
AF-A0A1G1GJ72-F1-model_v4 Twitching motility protein PilT 1.003 12 138 GO:0004518
GO:0046872
AF-A0A533Y1R3-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9977 12 138 GO:0000287
GO:0004540
GO:0090729
AF-A0A1J5D0A7-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9965 12 138 GO:0000287
GO:0004540
GO:0090729
AF-A0A846C1N0-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9964 12 138 GO:0000287
GO:0004540
GO:0090729
AF-A0A3M1WTJ7-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9955 12 138 GO:0000287
GO:0004540
GO:0090729

Map