F195080

General Info

Members Datasets Scaffolds Average Seq Length
145 97 290 317

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10180133|Ga0265316_101801332
Length 317
Sequence MSKVVVTGGAGFIGSSLVRALLRSGAERVTVVDNLSSGKQSNLVEVSDRVELCVADICDYGGIAPILAGAERVFHLAAIPSVPKSIADPVPSHESNIDGTFNVLRACQEGRAGRVVYAASSSAYGDTEVLPKVETMKPDPLSPYALQKLVGEYYCSVFTKCFDLETVGLRFFNVYGPRQDPSSPYSGVLSVFMTCLLERRAPTIFGDGEQSRDFTYVEDVAGLCLKAAAAPAGVVSGNVYNAGNGDRFTLNQVWRQLCAIEGVSIEPLYGPARAGDVKHSQADTRIARRDLGHDPQFSFDEGLRRTLEWYRHSLVQT

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
3 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
4 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
5 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
17 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
19 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
20 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
21 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
22 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
25 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
26 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
27 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
28 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
29 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
30 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
31 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
32 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
33 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
50 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
53 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
54 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
55 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
56 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
57 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
58 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
59 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
60 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
61 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
64 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
65 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
66 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
67 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
68 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
74 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
75 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
76 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
77 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
78 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
79 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
80 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
81 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
82 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
83 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
84 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
85 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
88 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
89 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
90 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
92 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
93 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
94 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
95 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
96 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
97 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.07
Rhizosphere 81.38
Stem 0
Stem Tuber 0
Unclassified 7.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10180133 3300031344 Bacteria 1574
2 Ga0070661_100195022 3300005344 Bacteria 1546
3 Ga0070678_100356971 3300005456 Unclassified 1258
4 Ga0070662_100094611 3300005457 Bacteria 2250
5 Ga0070681_10036327 3300005458 Bacteria 4947
6 Ga0070681_10110787 3300005458 Bacteria 2684
7 Ga0070681_10185327 3300005458 Bacteria 2002
8 Ga0070707_100426139 3300005468 Bacteria 1287
9 Ga0070679_100054641 3300005530 Bacteria 3976
10 Ga0068853_100007058 3300005539 Bacteria 8982
11 Ga0068855_100042557 3300005563 Bacteria 5381
12 Ga0068855_100347566 3300005563 Bacteria 1634
13 Ga0070664_100062295 3300005564 Bacteria 3180
14 Ga0068857_100132940 3300005577 Bacteria 2245
15 Ga0068856_100006767 3300005614 Bacteria 11222
16 Ga0068852_100158461 3300005616 Bacteria 2111
17 Ga0070717_10011598 3300006028 Bacteria 6700
18 Ga0070717_10040061 3300006028 Bacteria 3815
19 Ga0075431_100016075 3300006847 Bacteria 7594
20 Ga0075429_100258313 3300006880 Bacteria 1525
21 Ga0114129_10501314 3300009147 Bacteria 1586
22 Ga0105248_10414791 3300009177 Unclassified 1516
23 Ga0105237_10266551 3300009545 Bacteria 1716
24 Ga0105237_10401850 3300009545 Bacteria 1375
25 Ga0157373_10060347 3300013100 Bacteria 2687
26 Ga0157371_10057921 3300013102 Bacteria 2748
27 Ga0157370_10067031 3300013104 Bacteria 3393
28 Ga0157369_10002163 3300013105 Bacteria 23691
29 Ga0157369_10275732 3300013105 Bacteria 1752
30 Ga0157374_10015069 3300013296 Bacteria 6777
31 Ga0157372_10065815 3300013307 Bacteria 4071
32 Ga0157375_10331332 3300013308 Unclassified 1687
33 Ga0163163_10017999 3300014325 Bacteria 6600
34 Ga0157376_10296741 3300014969 Bacteria 1528
35 Ga0213872_10000306 3300021361 Bacteria 41866
36 Ga0213876_10004470 3300021384 Bacteria 7825
37 Ga0213876_10056356 3300021384 Unclassified 2074
38 Ga0213876_10157828 3300021384 Bacteria 1207
39 Ga0213875_10000006 3300021388 Bacteria 579005
40 Ga0213875_10000109 3300021388 Bacteria 94035
41 Ga0213875_10004573 3300021388 Bacteria 7555
42 Ga0213875_10019328 3300021388 Bacteria 3277
43 Ga0213875_10085765 3300021388 Unclassified 1469
44 Ga0213871_10004196 3300021441 Bacteria 2863
45 Ga0207707_10027910 3300025912 Bacteria 4936
46 Ga0207707_10069443 3300025912 Bacteria 3071
47 Ga0207707_10086314 3300025912 Bacteria 2743
48 Ga0207707_10188123 3300025912 Bacteria 1801
49 Ga0207695_10187350 3300025913 Bacteria 1988
50 Ga0207695_10259185 3300025913 Bacteria 1637
51 Ga0207706_10059208 3300025933 Bacteria 3373
52 Ga0207670_10060175 3300025936 Bacteria 2587
53 Ga0207665_10183126 3300025939 Bacteria 1518
54 Ga0207711_10129457 3300025941 Bacteria 2262
55 Ga0207679_10068533 3300025945 Bacteria 2666
56 Ga0207667_10036258 3300025949 Bacteria 5288
57 Ga0207667_10266623 3300025949 Bacteria 1751
58 Ga0207667_10343588 3300025949 Bacteria 1523
59 Ga0207639_10019532 3300026041 Bacteria 4835
60 Ga0207702_10013967 3300026078 Bacteria 6671
61 Ga0207702_10040517 3300026078 Bacteria 3905
62 Ga0207702_10302259 3300026078 Bacteria 1519
63 Ga0207641_10249102 3300026088 Bacteria 1658
64 Ga0207674_10300904 3300026116 Bacteria 1553
65 Ga0207683_10266006 3300026121 Bacteria 1566
66 Ga0207698_10089077 3300026142 Bacteria 2519
67 Ga0265323_10001409 3300028653 Bacteria 11842
68 Ga0265338_10006297 3300028800 Bacteria 15173
69 Ga0265324_10018042 3300029957 Bacteria 2560
70 Ga0265332_10006136 3300031238 Bacteria 5481
71 Ga0265320_10018323 3300031240 Bacteria 3858
72 Ga0265340_10022370 3300031247 Bacteria 3233
73 Ga0265339_10013925 3300031249 Bacteria 4866
74 Ga0265331_10046021 3300031250 Bacteria 2104
75 Ga0265316_10000767 3300031344 Bacteria 35377
76 Ga0265316_10001431 3300031344 Bacteria 25681
77 Ga0265316_10014257 3300031344 Bacteria 7007
78 Ga0265316_10022338 3300031344 Bacteria 5337
79 Ga0265316_10044620 3300031344 Bacteria 3524
80 Ga0265314_10004335 3300031711 Bacteria 13230
81 Ga0373923_0057181 3300035111 Bacteria 1649
82 Ga0373945_0075980 3300035116 Unclassified 1279
83 Ga0373946_0089019 3300035171 Bacteria 1365
84 Ga0373955_0116704 3300035172 Bacteria 1548
85 Ga0373935_0204337 3300035692 Bacteria 1366
86 Ga0373947_0118276 3300035725 Bacteria 1682
87 Ga0395898_0053935 3300037466 Bacteria 3925
88 Ga0436364_0048729 3300037853 Bacteria 13211
89 Ga0436364_0410812 3300037853 Bacteria 3327
90 Ga0436364_0419496 3300037853 Bacteria 1671
91 Ga0436364_0478514 3300037853 Bacteria 578677
92 Ga0436364_0747336 3300037853 Bacteria 2858
93 Ga0436364_0989831 3300037853 Bacteria 4291
94 Ga0436364_1008502 3300037853 Bacteria 66010
95 Ga0436364_1143178 3300037853 Bacteria 1593
96 Ga0436364_1209353 3300037853 Unclassified 3537
97 Ga0436364_1411269 3300037853 Bacteria 23539
98 Ga0436365_0305546 3300039437 Bacteria 6146
99 Ga0436365_1374180 3300039437 Bacteria 23375
100 Ga0436365_1678147 3300039437 Bacteria 10099
101 Ga0436360_0895238 3300039438 Bacteria 11881
102 Ga0436361_0793152 3300039447 Bacteria 90360
103 Ga0436361_1037484 3300039447 Bacteria 2370
104 Ga0436363_0814187 3300039450 Unclassified 1579
105 Ga0436363_0829683 3300039450 Bacteria 1808
106 Ga0436363_1489965 3300039450 Bacteria 4560
107 Ga0436362_0576272 3300039453 Bacteria 1723
108 Ga0436362_1171898 3300039453 Unclassified 2356
109 Ga0451577_0331251 3300042876 Bacteria 1381
110 Ga0453684_0551979 3300044712 Bacteria 1269
111 Ga0451576_0362057 3300045051 Bacteria 1519
112 Ga0466967_0125619 3300045976 Bacteria 2376
113 Ga0466967_0446461 3300045976 Bacteria 1264
114 Ga0495580_0000799 3300046472 Bacteria 27233
115 Ga0495580_0093274 3300046472 Bacteria 2095
116 Ga0495582_0055053 3300046473 Bacteria 2193
117 Ga0495664_0029290 3300046477 Bacteria 3219
118 Ga0495594_0014633 3300046499 Bacteria 4114
119 Ga0495594_0111844 3300046499 Bacteria 1540
120 Ga0495628_0031242 3300046516 Bacteria 4308
121 Ga0495665_0034518 3300046531 Bacteria 2705
122 Ga0495665_0154268 3300046531 Bacteria 1198
123 Ga0495646_0130708 3300046680 Bacteria 1414
124 Ga0495674_0001001 3300047319 Bacteria 27139
125 Ga0495675_0085922 3300047444 Bacteria 1978
126 Ga0495684_0072930 3300047471 Bacteria 2608
127 Ga0496112_0016126 3300048915 Bacteria 6986
128 Ga0496115_0033237 3300048918 Bacteria 4071
129 Ga0496115_0136472 3300048918 Bacteria 2023
130 Ga0501034_0045149 3300049571 Bacteria 4453
131 Ga0501034_0221169 3300049571 Bacteria 1846
132 Ga0501047_0153202 3300049581 Bacteria 2180
133 Ga0501074_0075154 3300049590 Bacteria 2426
134 Ga0501249_011316 3300049679 Bacteria 1872
135 Ga0501268_002604 3300049765 Unclassified 2388
136 Ga0501035_0127968 3300049822 Unclassified 2216
137 Ga0501044_0001024 3300049823 Bacteria 33666
138 Ga0501044_0002687 3300049823 Bacteria 20228
139 Ga0501044_0022562 3300049823 Bacteria 6707
140 nmdc:mga05p37_302806_c1 3300050507 Bacteria 1898
141 nmdc:mga09592_248338_c1 3300050508 Bacteria 1542
142 nmdc:mga06r32_67696_c1 3300050510 Bacteria 3448
143 nmdc:mga0rr50_494507_c1 3300050513 Bacteria 1039
144 nmdc:mga08x19_2910_c1 3300050514 Bacteria 10296
145 Ga0501082_0000167 3300060353 Bacteria 56214
146 Ga0265316_10180133
147 Ga0070661_100195022
148 Ga0070678_100356971
149 Ga0070662_100094611
150 Ga0070681_10036327
151 Ga0070681_10110787
152 Ga0070681_10185327
153 Ga0070707_100426139
154 Ga0070679_100054641
155 Ga0068853_100007058
156 Ga0068855_100042557
157 Ga0068855_100347566
158 Ga0070664_100062295
159 Ga0068857_100132940
160 Ga0068856_100006767
161 Ga0068852_100158461
162 Ga0070717_10011598
163 Ga0070717_10040061
164 Ga0075431_100016075
165 Ga0075429_100258313
166 Ga0114129_10501314
167 Ga0105248_10414791
168 Ga0105237_10266551
169 Ga0105237_10401850
170 Ga0157373_10060347
171 Ga0157371_10057921
172 Ga0157370_10067031
173 Ga0157369_10002163
174 Ga0157369_10275732
175 Ga0157374_10015069
176 Ga0157372_10065815
177 Ga0157375_10331332
178 Ga0163163_10017999
179 Ga0157376_10296741
180 Ga0213872_10000306
181 Ga0213876_10004470
182 Ga0213876_10056356
183 Ga0213876_10157828
184 Ga0213875_10000006
185 Ga0213875_10000109
186 Ga0213875_10004573
187 Ga0213875_10019328
188 Ga0213875_10085765
189 Ga0213871_10004196
190 Ga0207707_10027910
191 Ga0207707_10069443
192 Ga0207707_10086314
193 Ga0207707_10188123
194 Ga0207695_10187350
195 Ga0207695_10259185
196 Ga0207706_10059208
197 Ga0207670_10060175
198 Ga0207665_10183126
199 Ga0207711_10129457
200 Ga0207679_10068533
201 Ga0207667_10036258
202 Ga0207667_10266623
203 Ga0207667_10343588
204 Ga0207639_10019532
205 Ga0207702_10013967
206 Ga0207702_10040517
207 Ga0207702_10302259
208 Ga0207641_10249102
209 Ga0207674_10300904
210 Ga0207683_10266006
211 Ga0207698_10089077
212 Ga0265323_10001409
213 Ga0265338_10006297
214 Ga0265324_10018042
215 Ga0265332_10006136
216 Ga0265320_10018323
217 Ga0265340_10022370
218 Ga0265339_10013925
219 Ga0265331_10046021
220 Ga0265316_10000767
221 Ga0265316_10001431
222 Ga0265316_10014257
223 Ga0265316_10022338
224 Ga0265316_10044620
225 Ga0265314_10004335
226 Ga0373923_0057181
227 Ga0373945_0075980
228 Ga0373946_0089019
229 Ga0373955_0116704
230 Ga0373935_0204337
231 Ga0373947_0118276
232 Ga0395898_0053935
233 Ga0436364_0048729
234 Ga0436364_0410812
235 Ga0436364_0419496
236 Ga0436364_0478514
237 Ga0436364_0747336
238 Ga0436364_0989831
239 Ga0436364_1008502
240 Ga0436364_1143178
241 Ga0436364_1209353
242 Ga0436364_1411269
243 Ga0436365_0305546
244 Ga0436365_1374180
245 Ga0436365_1678147
246 Ga0436360_0895238
247 Ga0436361_0793152
248 Ga0436361_1037484
249 Ga0436363_0814187
250 Ga0436363_0829683
251 Ga0436363_1489965
252 Ga0436362_0576272
253 Ga0436362_1171898
254 Ga0451577_0331251
255 Ga0453684_0551979
256 Ga0451576_0362057
257 Ga0466967_0125619
258 Ga0466967_0446461
259 Ga0495580_0000799
260 Ga0495580_0093274
261 Ga0495582_0055053
262 Ga0495664_0029290
263 Ga0495594_0014633
264 Ga0495594_0111844
265 Ga0495628_0031242
266 Ga0495665_0034518
267 Ga0495665_0154268
268 Ga0495646_0130708
269 Ga0495674_0001001
270 Ga0495675_0085922
271 Ga0495684_0072930
272 Ga0496112_0016126
273 Ga0496115_0033237
274 Ga0496115_0136472
275 Ga0501034_0045149
276 Ga0501034_0221169
277 Ga0501047_0153202
278 Ga0501074_0075154
279 Ga0501249_011316
280 Ga0501268_002604
281 Ga0501035_0127968
282 Ga0501044_0001024
283 Ga0501044_0002687
284 Ga0501044_0022562
285 nmdc:mga05p37_302806_c1
286 nmdc:mga09592_248338_c1
287 nmdc:mga06r32_67696_c1
288 nmdc:mga0rr50_494507_c1
289 nmdc:mga08x19_2910_c1
290 Ga0501082_0000167

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

4

243

0.97

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

5

306

0.92

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

4

269

0.85

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

5

248

0.84

PF04321

RmlD_sub_bind

RmlD substrate binding domain

2

311

0.78

PF07993

NAD_binding_4

Male sterility protein

6

223

0.74

PF13460

NAD_binding_10

NAD(P)H-binding

8

155

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sb8-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4-epimerase complexed with udp-n-acetylgalactosamine 0.9439 2 311
3ruc-assembly1.cif.gz_A specific recognition of n-acetylated substrates and domain flexibility in wbgu: a udp-galnac 4-epimerase 0.938 2 310
4zrn-assembly1.cif.gz_B crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima 0.9359 3 310
6wjb-assembly1.cif.gz_A udp-glcnac c4-epimerase from pseudomonas protegens in complex with nad and udp-glcnac 0.9351 2 305
6wja-assembly1.cif.gz_A udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac 0.9339 2 305
ID Description Score Start End Superfamily
af_K7VJC9_94_197_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9429 3 58 3.40.50.720
3dmeB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9407 2 33 3.50.50.60
4zrmB02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9309 175 309 3.90.25.10
af_Q2G289_4_319_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9243 1 313 3.40.50.720
6dntA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9187 175 310 3.90.25.10
ID Description Score Start End GO Terms
AF-A0A7Z9JM87-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9759 133 296
AF-A0A534W7M1-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9756 160 315
AF-A0A829I4J9-F1-model_v4 deleted 0.9715 141 312
AF-A0A7X6UN86-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9706 161 313
AF-A0A7C2EL58-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9677 92 313 GO:0016491

Map