F195035

General Info

Members Datasets Scaffolds Average Seq Length
145 115 134 197

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10028087|Ga0307515_100280877
Length 209
Sequence VTIKLEYPEGATPLDPNELGGLKYKHITTQGELDELEQANIASGLRWLARTRRKDILSDDFAIELHRRLLGEVWDWAGAFRQTGKNIGVDPIQIGIQLRGLMDDARYWTEHKTYPPKEAAVRLHHRLVLIHPFSNGNGRHARIMADTVLDKVYGTEPIDWTAGSDLQKISERRTAYIAALKAADGHDMGPLLAFIDLKHVAQNCAAVLR

Samples

Sample ID Description Type Environment
1 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
2 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
3 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
4 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
5 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
6 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
7 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
8 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
9 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
10 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
11 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
12 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
13 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
14 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
61 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
62 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
66 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
87 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
91 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
103 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
104 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
108 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
109 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
110 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
111 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
112 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
113 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
114 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
115 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.72
Metatranscriptomes 0.69
Isolates 7.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.17
Nodule 8.28
Rhizoplane 4.83
Rhizosphere 60.69
Stem 0
Stem Tuber 0
Unclassified 11.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1001978 3300000546 Bacteria 2640
2 JGI25156J39149_1008903 3300002705 Bacteria 2485
3 JGI25157J39369_1000886 3300002741 Bacteria 14411
4 JGI25159J45721_1000382 3300002987 Bacteria 20518
5 rootH2_10070935 3300003320 Bacteria 5411
6 rootL2_10117530 3300003322 Bacteria 1270
7 JGI25160J50197_1000357 3300003354 Bacteria 30225
8 JGI25160J50197_1049501 3300003354 Bacteria 901
9 JGI25161J50226_1000272 3300003374 Bacteria 30225
10 JGI25404J52841_10016236 3300003659 Bacteria 1615
11 Ga0055542_1000255 3300003762 Bacteria 60283
12 Ga0055543_1000161 3300004625 Bacteria 56068
13 Ga0065165_1000553 3300005262 Bacteria 56068
14 Ga0065165_1013661 3300005262 Bacteria 3211
15 Ga0070666_10150403 3300005335 Bacteria 1624
16 Ga0070703_10043130 3300005406 Bacteria 1413
17 Ga0070709_10046809 3300005434 Bacteria 2691
18 Ga0070714_100318561 3300005435 Bacteria 1454
19 Ga0070713_100177983 3300005436 Bacteria 1910
20 Ga0070710_10026646 3300005437 Bacteria 3074
21 Ga0070711_100163122 3300005439 Bacteria 1691
22 Ga0070711_100520908 3300005439 Bacteria 983
23 Ga0070705_100141014 3300005440 Bacteria 1586
24 Ga0070708_100002516 3300005445 Bacteria 14147
25 Ga0070708_100058820 3300005445 Bacteria 3426
26 Ga0070706_100024530 3300005467 Bacteria 5552
27 Ga0070706_100079354 3300005467 Unclassified 3038
28 Ga0070699_100109598 3300005518 Bacteria 2423
29 Ga0070697_100030931 3300005536 Bacteria 4302
30 Ga0070695_100113509 3300005545 Bacteria 1843
31 Ga0070696_100192050 3300005546 Bacteria 1520
32 Ga0068857_100281734 3300005577 Bacteria 1529
33 Ga0068854_100063662 3300005578 Bacteria 2678
34 Ga0068852_100323024 3300005616 Bacteria 1499
35 Ga0068858_100048032 3300005842 Bacteria 3956
36 Ga0081540_1000005 3300005983 Bacteria 227052
37 Ga0081540_1033707 3300005983 Bacteria 2775
38 Ga0070717_10001397 3300006028 Bacteria 16635
39 Ga0070717_10115520 3300006028 Bacteria 2294
40 Ga0075364_10422246 3300006051 Bacteria 910
41 Ga0070716_100005323 3300006173 Bacteria 6222
42 Ga0070712_100003244 3300006175 Bacteria 10026
43 Ga0070712_100052185 3300006175 Bacteria 2851
44 Ga0099826_10000106 3300006948 Bacteria 38634
45 Ga0099795_10066712 3300007788 Bacteria 1348
46 Ga0105240_10215373 3300009093 Bacteria 2241
47 Ga0105245_10010810 3300009098 Bacteria 7942
48 Ga0105241_10009993 3300009174 Bacteria 6970
49 Ga0105241_10084493 3300009174 Bacteria 2492
50 Ga0105242_10729520 3300009176 Unclassified 973
51 Ga0105237_10000017 3300009545 Bacteria 246292
52 Ga0105237_10618625 3300009545 Bacteria 1090
53 Ga0105238_10142655 3300009551 Bacteria 2372
54 Ga0105239_10067835 3300010375 Bacteria 3919
55 Ga0105239_10258493 3300010375 Bacteria 1957
56 Ga0105239_10626984 3300010375 Bacteria 1227
57 Ga0157374_10203318 3300013296 Bacteria 1940
58 Ga0157378_10050480 3300013297 Bacteria 3702
59 Ga0157378_10160325 3300013297 Bacteria 2103
60 Ga0163162_10046736 3300013306 Bacteria 4339
61 Ga0163162_10252253 3300013306 Bacteria 1896
62 Ga0163162_10690729 3300013306 Bacteria 1143
63 Ga0157372_10002149 3300013307 Bacteria 21435
64 Ga0157372_10028262 3300013307 Bacteria 6120
65 Ga0157372_11413127 3300013307 Bacteria 802
66 Ga0157376_10648713 3300014969 Unclassified 1056
67 Ga0224569_108876 3300022732 Unclassified 717
68 Ga0228711_1001069 3300022739 Bacteria 38641
69 Ga0228710_1001146 3300022740 Bacteria 38624
70 Ga0209026_1000083 3300025250 Bacteria 190199
71 Ga0209148_1000037 3300025254 Bacteria 494767
72 Ga0209148_1007336 3300025254 Bacteria 2301
73 Ga0209759_1000310 3300025256 Bacteria 65918
74 Ga0209455_1000036 3300025272 Bacteria 473309
75 Ga0209130_1000122 3300025284 Bacteria 126935
76 Ga0207426_1000083 3300025302 Bacteria 298770
77 Ga0207426_1025476 3300025302 Bacteria 1991
78 Ga0207699_10066460 3300025906 Bacteria 2189
79 Ga0207699_10138763 3300025906 Unclassified 1595
80 Ga0207684_10044615 3300025910 Bacteria 3760
81 Ga0207707_10408673 3300025912 Bacteria 1165
82 Ga0207695_10000378 3300025913 Bacteria 101352
83 Ga0207695_10043791 3300025913 Bacteria 4766
84 Ga0207695_10181573 3300025913 Bacteria 2025
85 Ga0207671_10000006 3300025914 Bacteria 836809
86 Ga0207671_10026593 3300025914 Unclassified 4333
87 Ga0207693_10018727 3300025915 Bacteria 5511
88 Ga0207693_10447791 3300025915 Unclassified 1009
89 Ga0207694_10084780 3300025924 Bacteria 2492
90 Ga0207700_10356251 3300025928 Unclassified 1275
91 Ga0207704_10390692 3300025938 Bacteria 1095
92 Ga0207665_10000591 3300025939 Bacteria 24420
93 Ga0207665_10086920 3300025939 Bacteria 2161
94 Ga0207665_10724863 3300025939 Unclassified 783
95 Ga0207640_10039031 3300025981 Bacteria 3002
96 Ga0207658_11106646 3300025986 Unclassified 724
97 Ga0207703_10069851 3300026035 Bacteria 2898
98 Ga0207703_10181667 3300026035 Bacteria 1857
99 Ga0207698_10424428 3300026142 Bacteria 1277
100 Ga0209282_1000160 3300027666 Bacteria 38641
101 Ga0307515_10028087 3300028794 Bacteria 9579
102 Ga0265762_1030620 3300030760 Bacteria 1021
103 Ga0315914_1001133 3300031967 Bacteria 38640
104 Ga0315913_1006400 3300033430 Bacteria 14243
105 Ga0373937_0914726 3300036401 Bacteria 826
106 Ga0395905_0013487 3300037471 Bacteria 7830
107 Ga0400483_214434 3300039062 Bacteria 4114
108 Ga0439465_0023697 3300041413 Bacteria 1932
109 Ga0451577_0036084 3300042876 Bacteria 4452
110 Ga0453683_0055384 3300044673 Bacteria 2482
111 Ga0453684_0000749 3300044712 Bacteria 113060
112 Ga0451576_0261480 3300045051 Bacteria 1809
113 Ga0451576_0524574 3300045051 Unclassified 1244
114 Ga0466958_0439760 3300045836 Unclassified 844
115 Ga0495643_0021744 3300046522 Bacteria 3673
116 Ga0496100_0205552 3300048903 Bacteria 1437
117 Ga0496102_0001003 3300048905 Bacteria 26467
118 Ga0496103_0054469 3300048906 Bacteria 2479
119 Ga0496104_0009862 3300048907 Bacteria 8523
120 Ga0496104_0349258 3300048907 Bacteria 1392
121 Ga0496106_0272214 3300048909 Bacteria 1356
122 Ga0496107_0173921 3300048910 Bacteria 1598
123 Ga0496121_0083257 3300048924 Bacteria 2526
124 Ga0496126_0180920 3300048929 Bacteria 1791
125 Ga0496126_0527640 3300048929 Bacteria 940
126 Ga0501047_0294633 3300049581 Bacteria 1466
127 Ga0501077_0084870 3300049593 Bacteria 2007
128 nmdc:mga03683_372937_c1 3300050489 Unclassified 678
129 Ga0500641_0146947 3300053096 Bacteria 1018
130 Ga0500628_000139 3300053129 Bacteria 14052
131 Ga0500568_0000035 3300053139 Bacteria 137912
132 Ga0500573_0000394 3300053140 Bacteria 18643
133 Ga0500609_001101 3300053731 Bacteria 4039
134 Ga0500661_007773 3300055283 Bacteria 1978

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050489 nmdc:mga03683_372937_c1 nmdc:mga03683_372937_c1_128_640 164
2 3300053129 Ga0500628_000139 Ga0500628_000139_6413_6961 174
3 iso_pu_bacteria 2882632389 2882632448 176
4 3300025915 Ga0207693_10447791 Ga0207693_104477912 178
5 3300025986 Ga0207658_11106646 Ga0207658_111066462 178
6 iso_pu_bacteria 2740891818 2740995335 187
7 iso_pu_bacteria 2906626472 2906635045 189
8 iso_pu_bacteria 2932794094 2932799303 189
9 iso_pu_bacteria 2932801729 2932802297 189
10 iso_pu_bacteria 2935883170 2935889462 189
11 iso_pu_bacteria 637000159 637074948 189
12 3300049593 Ga0501077_0084870 Ga0501077_0084870_207_797 190
13 3300055283 Ga0500661_007773 Ga0500661_007773_1217_1813 190
14 iso_pu_bacteria 2585427633 2585992712 190
15 iso_pu_bacteria 2585427634 2586003445 190
16 iso_pu_bacteria 2885312484 2885318180 190
17 iso_pu_bacteria 3004334049 3004334865 190
18 3300009545 Ga0105237_10000017 Ga0105237_100000176 191
19 3300025914 Ga0207671_10000006 Ga0207671_1000000682 191
20 3300003322 rootL2_10117530 rootL2_101175302 192
21 3300003354 JGI25160J50197_1049501 JGI25160J50197_10495011 192
22 3300003659 JGI25404J52841_10016236 JGI25404J52841_100162362 192
23 3300005262 Ga0065165_1013661 Ga0065165_10136612 192
24 3300005577 Ga0068857_100281734 Ga0068857_1002817343 192
25 3300005578 Ga0068854_100063662 Ga0068854_1000636622 192
26 3300005616 Ga0068852_100323024 Ga0068852_1003230243 192
27 3300005983 Ga0081540_1000005 Ga0081540_1000005121 192
28 3300006051 Ga0075364_10422246 Ga0075364_104222461 192
29 3300007788 Ga0099795_10066712 Ga0099795_100667122 192
30 3300009174 Ga0105241_10084493 Ga0105241_100844933 192
31 3300010375 Ga0105239_10067835 Ga0105239_100678353 192
32 3300025302 Ga0207426_1025476 Ga0207426_10254764 192
33 3300025913 Ga0207695_10000378 Ga0207695_1000037813 192
34 3300025913 Ga0207695_10181573 Ga0207695_101815732 192
35 3300025924 Ga0207694_10084780 Ga0207694_100847803 192
36 3300025981 Ga0207640_10039031 Ga0207640_100390313 192
37 3300026142 Ga0207698_10424428 Ga0207698_104244282 192
38 3300042876 Ga0451577_0036084 Ga0451577_0036084_739_1323 192
39 3300044673 Ga0453683_0055384 Ga0453683_0055384_67_651 192
40 3300044712 Ga0453684_0000749 Ga0453684_0000749_2158_2742 192
41 3300045051 Ga0451576_0524574 Ga0451576_0524574_369_953 192
42 3300053096 Ga0500641_0146947 Ga0500641_0146947_228_830 192
43 3300002705 JGI25156J39149_1008903 JGI25156J39149_10089032 193
44 3300002741 JGI25157J39369_1000886 JGI25157J39369_100088614 193
45 3300002987 JGI25159J45721_1000382 JGI25159J45721_100038215 193
46 3300003354 JGI25160J50197_1000357 JGI25160J50197_100035723 193
47 3300003374 JGI25161J50226_1000272 JGI25161J50226_100027223 193
48 3300003762 Ga0055542_1000255 Ga0055542_10002553 193
49 3300004625 Ga0055543_1000161 Ga0055543_100016144 193
50 3300005262 Ga0065165_1000553 Ga0065165_100055344 193
51 3300005842 Ga0068858_100048032 Ga0068858_1000480322 193
52 3300005983 Ga0081540_1033707 Ga0081540_10337072 193
53 3300006948 Ga0099826_10000106 Ga0099826_1000010632 193
54 3300009551 Ga0105238_10142655 Ga0105238_101426553 193
55 3300010375 Ga0105239_10258493 Ga0105239_102584933 193
56 3300013296 Ga0157374_10203318 Ga0157374_102033183 193
57 3300013306 Ga0163162_10046736 Ga0163162_100467364 193
58 3300022739 Ga0228711_1001069 Ga0228711_10010696 193
59 3300022740 Ga0228710_1001146 Ga0228710_10011466 193
60 3300025250 Ga0209026_1000083 Ga0209026_1000083144 193
61 3300025254 Ga0209148_1000037 Ga0209148_1000037259 193
62 3300025254 Ga0209148_1007336 Ga0209148_10073363 193
63 3300025256 Ga0209759_1000310 Ga0209759_10003109 193
64 3300025272 Ga0209455_1000036 Ga0209455_1000036236 193
65 3300025284 Ga0209130_1000122 Ga0209130_100012229 193
66 3300025302 Ga0207426_1000083 Ga0207426_1000083277 193
67 3300026035 Ga0207703_10181667 Ga0207703_101816672 193
68 3300027666 Ga0209282_1000160 Ga0209282_100016031 193
69 3300028794 Ga0307515_10028087 Ga0307515_100280877 193
70 3300031967 Ga0315914_1001133 Ga0315914_10011336 193
71 3300033430 Ga0315913_1006400 Ga0315913_10064002 193
72 3300037471 Ga0395905_0013487 Ga0395905_0013487_282_881 193
73 3300039062 Ga0400483_214434 Ga0400483_214434_2422_3027 193
74 3300041413 Ga0439465_0023697 Ga0439465_0023697_889_1491 193
75 3300046522 Ga0495643_0021744 Ga0495643_0021744_2205_2816 193
76 3300048924 Ga0496121_0083257 Ga0496121_0083257_914_1537 193
77 3300048929 Ga0496126_0527640 Ga0496126_0527640_210_812 193
78 3300053139 Ga0500568_0000035 Ga0500568_0000035_117168_117773 193
79 3300053140 Ga0500573_0000394 Ga0500573_0000394_4685_5272 193
80 3300053731 Ga0500609_001101 Ga0500609_001101_2392_3018 193
81 3300005406 Ga0070703_10043130 Ga0070703_100431302 194
82 3300005545 Ga0070695_100113509 Ga0070695_1001135092 194
83 3300005546 Ga0070696_100192050 Ga0070696_1001920501 194
84 3300009174 Ga0105241_10009993 Ga0105241_100099934 194
85 3300010375 Ga0105239_10626984 Ga0105239_106269841 194
86 3300014969 Ga0157376_10648713 Ga0157376_106487132 194
87 3300026035 Ga0207703_10069851 Ga0207703_100698512 194
88 3300048905 Ga0496102_0001003 Ga0496102_0001003_11864_12448 194
89 3300048906 Ga0496103_0054469 Ga0496103_0054469_1359_1943 194
90 3300048907 Ga0496104_0009862 Ga0496104_0009862_6922_7506 194
91 3300048909 Ga0496106_0272214 Ga0496106_0272214_516_1100 194
92 3300048910 Ga0496107_0173921 Ga0496107_0173921_499_1083 194
93 3300005434 Ga0070709_10046809 Ga0070709_100468093 195
94 3300005435 Ga0070714_100318561 Ga0070714_1003185612 195
95 3300005436 Ga0070713_100177983 Ga0070713_1001779831 195
96 3300005437 Ga0070710_10026646 Ga0070710_100266465 195
97 3300005439 Ga0070711_100163122 Ga0070711_1001631222 195
98 3300005439 Ga0070711_100520908 Ga0070711_1005209082 195
99 3300005440 Ga0070705_100141014 Ga0070705_1001410142 195
100 3300005445 Ga0070708_100058820 Ga0070708_1000588204 195
101 3300005467 Ga0070706_100079354 Ga0070706_1000793543 195
102 3300006028 Ga0070717_10001397 Ga0070717_1000139711 195
103 3300006028 Ga0070717_10115520 Ga0070717_101155201 195
104 3300006173 Ga0070716_100005323 Ga0070716_1000053236 195
105 3300006175 Ga0070712_100003244 Ga0070712_1000032446 195
106 3300006175 Ga0070712_100052185 Ga0070712_1000521852 195
107 3300009093 Ga0105240_10215373 Ga0105240_102153732 195
108 3300009098 Ga0105245_10010810 Ga0105245_100108101 195
109 3300009176 Ga0105242_10729520 Ga0105242_107295201 195
110 3300009545 Ga0105237_10618625 Ga0105237_106186252 195
111 3300013297 Ga0157378_10050480 Ga0157378_100504803 195
112 3300013297 Ga0157378_10160325 Ga0157378_101603254 195
113 3300013306 Ga0163162_10252253 Ga0163162_102522532 195
114 3300013306 Ga0163162_10690729 Ga0163162_106907292 195
115 3300013307 Ga0157372_10002149 Ga0157372_100021491 195
116 3300025906 Ga0207699_10066460 Ga0207699_100664604 195
117 3300025906 Ga0207699_10138763 Ga0207699_101387632 195
118 3300025912 Ga0207707_10408673 Ga0207707_104086732 195
119 3300025913 Ga0207695_10043791 Ga0207695_100437915 195
120 3300025915 Ga0207693_10018727 Ga0207693_100187278 195
121 3300025928 Ga0207700_10356251 Ga0207700_103562512 195
122 3300025938 Ga0207704_10390692 Ga0207704_103906922 195
123 3300025939 Ga0207665_10000591 Ga0207665_1000059123 195
124 3300025939 Ga0207665_10086920 Ga0207665_100869202 195
125 3300025939 Ga0207665_10724863 Ga0207665_107248632 195
126 3300030760 Ga0265762_1030620 Ga0265762_10306202 195
127 3300036401 Ga0373937_0914726 Ga0373937_0914726_119_709 195
128 3300045051 Ga0451576_0261480 Ga0451576_0261480_827_1417 195
129 3300045836 Ga0466958_0439760 Ga0466958_0439760_190_789 195
130 3300048903 Ga0496100_0205552 Ga0496100_0205552_317_904 195
131 3300048907 Ga0496104_0349258 Ga0496104_0349258_226_816 195
132 3300000546 LJNas_1001978 LJNas_10019783 196
133 3300003320 rootH2_10070935 rootH2_100709353 196
134 3300005335 Ga0070666_10150403 Ga0070666_101504032 196
135 3300005445 Ga0070708_100002516 Ga0070708_10000251610 196
136 3300005467 Ga0070706_100024530 Ga0070706_1000245306 196
137 3300005518 Ga0070699_100109598 Ga0070699_1001095983 196
138 3300005536 Ga0070697_100030931 Ga0070697_1000309315 196
139 3300013307 Ga0157372_10028262 Ga0157372_100282628 196
140 3300013307 Ga0157372_11413127 Ga0157372_114131271 196
141 3300022732 Ga0224569_108876 Ga0224569_1088761 196
142 3300025910 Ga0207684_10044615 Ga0207684_100446153 196
143 3300025914 Ga0207671_10026593 Ga0207671_100265935 196
144 3300048929 Ga0496126_0180920 Ga0496126_0180920_1126_1716 196
145 3300049581 Ga0501047_0294633 Ga0501047_0294633_623_1219 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02661

Fic

Fic/DOC family

56

149

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bep-assembly1.cif.gz_A crystal structure of the legionella pneumophila fic domain-containing effector ankx protein (apo-form) 0.8483 95 160
2nud-assembly2.cif.gz_B the structure of the type iii effector avrb complexed with a high-affinity rin4 peptide 0.7903 92 158
6i7h-assembly1.cif.gz_A-2 crystal structure of dimeric ficd mutant k256s 0.7896 16 195
5cgl-assembly1.cif.gz_B fic protein from neisseria meningitidis (nmfic) mutant e102r in dimeric form 0.7894 35 194
5cgl-assembly1.cif.gz_A fic protein from neisseria meningitidis (nmfic) mutant e102r in dimeric form 0.7877 35 194
ID Description Score Start End Superfamily
af_Q54WZ7_1_134_1.10.3290.10 Mainly Alpha;Orthogonal Bundle;Fic-like fold;Fido-like domain 0.8257 81 195 1.10.3290.10
4u0uB02 Mainly Alpha;Orthogonal Bundle;Fic-like fold;Fido-like domain 0.7799 16 195 1.10.3290.10
5jfzE00 Mainly Alpha;Orthogonal Bundle;Fic-like fold;Fido-like domain 0.7763 24 193 1.10.3290.10
af_Q54RJ6_2_142_1.10.3290.10 Mainly Alpha;Orthogonal Bundle;Fic-like fold;Fido-like domain 0.7727 79 194 1.10.3290.10
3zcbA00 Mainly Alpha;Orthogonal Bundle;Fic-like fold;Fido-like domain 0.7706 14 195 1.10.3290.10
ID Description Score Start End GO Terms
AF-A0A8B0SIM7-F1-model_v4 Fic family protein 0.9919 118 196
AF-A0A7T1I6H7-F1-model_v4 Fic family protein 0.9894 79 161
AF-A0A0T5ZC49-F1-model_v4 Mobile mystery protein B 0.9841 92 196
AF-A0A2Z2PJS2-F1-model_v4 Mobilization protein 0.9836 117 196
AF-A0A523GDI9-F1-model_v4 Mobile mystery protein B 0.9815 58 196

Feature Viewer

pLDDT pTM Quality
87.48 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map