F194401

General Info

Members Datasets Scaffolds Average Seq Length
145 120 98 638

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100069478|Ga0075434_1000694781
Length 719
Sequence MLIQSSLNPVRSSLSRRQVLKLAVAASGVAVVRQPDQAWAFLSSPNSHLSLAGSPNAIGPKEELNLPRSVLYYGSEEPLPEPIELRAGPLAMIFETGNAFLRYIRLGNREILRGIYVAVRDRNWGTVPPKVLNLKTEIEGASFQLHFDVECKEGDIDFRWRGSITGSEQGSVEFSMNGTARSAFKRNRLGFAVLHPIRGCAGQSCKIEKVDGTSEQGTFPLFVSPQQPFKDMRAISHQVIPDVTARVAFEGDTFEMEDQRNWTDASYKTYCTPLSLPYPVEVPLGTTVAQAIKLDLQGRIPSKPPQVAVTNFPAVRLTLTDKALPLPQIGLGMASHGQPLTLKERERLIALHLSHLRVDLRLAENSYRPIFKLAAAEAQALRISLEVALFLSDSGEAELRELASELSQVKPPISSWLVFQTKEKSTQESAVRLARRTLSSYDPKAKFGAGTDAYFAEFNRGRPPVTALDLACYSMNPQVHAYDNATLVETLDAQGGTVESARRFVGKLPLAVSPITLKPRFNPSAPGPQPEPVPGVLPSQVDVRQMSLFGAGWTLGSIKNLAASGVSSLTYYETTGWRGVMETEAGSALPSQFRSIAGGVFPLYHVLADLGEFESGSFLPCISSDALSVEGLVLEKGNRKCLIATNLGPKLQYLTILNSNLGGYVRVRRLDESNAEEAMRLPEAFREKPGLLHQVGGNQIEISLLPYSTIRIDPAKDKM

Samples

Sample ID Description Type Environment
1 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
2 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
3 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
4 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
5 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
6 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
7 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
8 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
9 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
10 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
11 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
12 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
13 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
14 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
15 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
16 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
17 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
18 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
19 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
20 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
21 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
22 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
23 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
24 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
25 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
26 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
27 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
28 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
29 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
30 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
31 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
32 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
33 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
34 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
35 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
36 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
37 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
38 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
39 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
40 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
41 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
42 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
43 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
44 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
45 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
75 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
76 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
77 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
80 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
81 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
82 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
93 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
97 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
102 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
118 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
119 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
120 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 67.59
Metatranscriptomes 0
Isolates 32.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 30.34
Rhizoplane 0
Rhizosphere 65.52
Stem 0
Stem Tuber 0
Unclassified 4.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10000096 3300005327 Bacteria 77523
2 Ga0070687_100036320 3300005343 Unclassified 2454
3 Ga0070688_100013441 3300005365 Bacteria 4616
4 Ga0070713_100000669 3300005436 Bacteria 21917
5 Ga0070708_100004192 3300005445 Bacteria 11330
6 Ga0070708_100006229 3300005445 Bacteria 9483
7 Ga0070707_100005921 3300005468 Bacteria 11411
8 Ga0070699_100069982 3300005518 Bacteria 3049
9 Ga0070697_100006766 3300005536 Bacteria 8892
10 Ga0070686_100007748 3300005544 Bacteria 6003
11 Ga0068855_100070725 3300005563 Bacteria 4059
12 Ga0068856_100046980 3300005614 Bacteria 4253
13 Ga0068860_100000091 3300005843 Bacteria 151143
14 Ga0075428_100032256 3300006844 Bacteria 5785
15 Ga0075428_100057226 3300006844 Bacteria 4268
16 Ga0075428_100136443 3300006844 Bacteria 2667
17 Ga0075430_100016058 3300006846 Bacteria 6374
18 Ga0075433_10045872 3300006852 Bacteria 3800
19 Ga0075434_100069478 3300006871 Bacteria 3511
20 Ga0075434_100074308 3300006871 Bacteria 3393
21 Ga0105240_10005731 3300009093 Bacteria 18424
22 Ga0111539_10004034 3300009094 Bacteria 19278
23 Ga0111539_10047830 3300009094 Bacteria 5111
24 Ga0111539_10140755 3300009094 Unclassified 2824
25 Ga0111539_10152489 3300009094 Bacteria 2705
26 Ga0114129_10099050 3300009147 Bacteria 4035
27 Ga0105239_10004379 3300010375 Bacteria 16910
28 Ga0157370_10035497 3300013104 Bacteria 4844
29 Ga0157369_10018490 3300013105 Bacteria 7813
30 Ga0157372_10012257 3300013307 Bacteria 9131
31 Ga0207705_10000141 3300025909 Bacteria 77000
32 Ga0207684_10007123 3300025910 Bacteria 10106
33 Ga0207695_10007239 3300025913 Bacteria 14173
34 Ga0207646_10011222 3300025922 Bacteria 8699
35 Ga0268264_10000386 3300028381 Bacteria 63458
36 Ga0265319_1007631 3300028563 Bacteria 4833
37 Ga0265334_10000983 3300028573 Bacteria 14114
38 Ga0265318_10001019 3300028577 Bacteria 17905
39 Ga0265336_10007408 3300028666 Bacteria 3900
40 Ga0265338_10001840 3300028800 Bacteria 33293
41 Ga0265338_10010237 3300028800 Bacteria 11043
42 Ga0265338_10031906 3300028800 Bacteria 5154
43 Ga0265330_10004176 3300031235 Bacteria 7368
44 Ga0265332_10002456 3300031238 Bacteria 9442
45 Ga0265328_10011392 3300031239 Bacteria 3553
46 Ga0265320_10026334 3300031240 Bacteria 3045
47 Ga0265325_10001203 3300031241 Bacteria 18422
48 Ga0265329_10001388 3300031242 Bacteria 11725
49 Ga0265329_10004405 3300031242 Bacteria 5866
50 Ga0265340_10004364 3300031247 Bacteria 7916
51 Ga0265339_10004119 3300031249 Bacteria 10019
52 Ga0265331_10013603 3300031250 Bacteria 4369
53 Ga0265327_10007091 3300031251 Bacteria 8764
54 Ga0265316_10005368 3300031344 Bacteria 12471
55 Ga0265313_10002373 3300031595 Bacteria 16370
56 Ga0265314_10000389 3300031711 Bacteria 59681
57 Ga0265314_10004580 3300031711 Bacteria 12765
58 Ga0265342_10020204 3300031712 Bacteria 4279
59 Ga0316577_10012877 3300031733 Bacteria 4564
60 Ga0307410_10008384 3300031852 Bacteria 5728
61 Ga0307415_100000881 3300032126 Bacteria 13723
62 Ga0316582_0001368 3300036647 Bacteria 10614
63 Ga0316584_0000553 3300036712 Bacteria 20069
64 Ga0395898_0015443 3300037466 Bacteria 7831
65 Ga0436364_0183340 3300037853 Bacteria 6804
66 Ga0436364_0940001 3300037853 Bacteria 11711
67 Ga0436365_1311032 3300039437 Bacteria 3316
68 Ga0439462_0001110 3300042015 Bacteria 5818
69 Ga0439446_0002224 3300042156 Bacteria 4633
70 Ga0451577_0000896 3300042876 Bacteria 44127
71 Ga0451577_0005475 3300042876 Bacteria 13008
72 Ga0453683_0000520 3300044673 Bacteria 43384
73 Ga0453684_0002956 3300044712 Bacteria 39829
74 Ga0453684_0010985 3300044712 Bacteria 15304
75 Ga0453684_0014624 3300044712 Bacteria 12526
76 Ga0453684_0024690 3300044712 Bacteria 8767
77 Ga0453684_0232644 3300044712 Unclassified 2127
78 Ga0451576_0002147 3300045051 Bacteria 30559
79 Ga0451576_0006088 3300045051 Bacteria 14873
80 Ga0451576_0019405 3300045051 Bacteria 7421
81 Ga0451576_0023607 3300045051 Bacteria 6657
82 Ga0495625_0007105 3300046660 Bacteria 9836
83 Ga0501033_0007254 3300049570 Bacteria 8646
84 Ga0501043_0020792 3300049579 Bacteria 5147
85 Ga0501046_0000212 3300049580 Bacteria 60680
86 Ga0501047_0009903 3300049581 Bacteria 9011
87 Ga0501067_0051811 3300049583 Bacteria 2274
88 Ga0501035_0002914 3300049822 Bacteria 16472
89 Ga0501035_0022669 3300049822 Bacteria 5768
90 Ga0501035_0029173 3300049822 Bacteria 5031
91 Ga0501035_0045705 3300049822 Bacteria 3939
92 Ga0501044_0034729 3300049823 Bacteria 5286
93 Ga0501044_0108544 3300049823 Bacteria 2785
94 nmdc:mga09592_34790_c1 3300050508 Bacteria 4213
95 nmdc:mga08y16_242737_c1 3300050511 Unclassified 1862
96 nmdc:mga08y16_8664_c1 3300050511 Bacteria 10667
97 nmdc:mga0a205_22526_c1 3300050515 Bacteria 5968
98 Ga0495612_0012484 3300053078 Unclassified 3425

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049583 Ga0501067_0051811 Ga0501067_0051811_459_2243 572
2 3300031852 Ga0307410_10008384 Ga0307410_100083843 582
3 3300032126 Ga0307415_100000881 Ga0307415_10000088110 582
4 3300042876 Ga0451577_0005475 Ga0451577_0005475_4565_6322 582
5 3300044712 Ga0453684_0014624 Ga0453684_0014624_3301_5058 582
6 3300045051 Ga0451576_0006088 Ga0451576_0006088_4019_5776 582
7 3300005843 Ga0068860_100000091 Ga0068860_10000009135 587
8 3300028381 Ga0268264_10000386 Ga0268264_1000038627 587
9 3300049580 Ga0501046_0000212 Ga0501046_0000212_54249_56030 588
10 3300028563 Ga0265319_1007631 Ga0265319_10076313 598
11 3300028573 Ga0265334_10000983 Ga0265334_1000098314 598
12 3300028577 Ga0265318_10001019 Ga0265318_100010194 598
13 3300028800 Ga0265338_10010237 Ga0265338_1001023710 598
14 3300031235 Ga0265330_10004176 Ga0265330_100041764 598
15 3300031238 Ga0265332_10002456 Ga0265332_100024565 598
16 3300031239 Ga0265328_10011392 Ga0265328_100113923 598
17 3300031240 Ga0265320_10026334 Ga0265320_100263342 598
18 3300031241 Ga0265325_10001203 Ga0265325_1000120313 598
19 3300031242 Ga0265329_10001388 Ga0265329_100013886 598
20 3300031247 Ga0265340_10004364 Ga0265340_100043645 598
21 3300031249 Ga0265339_10004119 Ga0265339_100041194 598
22 3300031250 Ga0265331_10013603 Ga0265331_100136033 598
23 3300031251 Ga0265327_10007091 Ga0265327_100070914 598
24 3300031344 Ga0265316_10005368 Ga0265316_1000536810 598
25 3300031595 Ga0265313_10002373 Ga0265313_100023735 598
26 3300031711 Ga0265314_10004580 Ga0265314_100045804 598
27 3300031712 Ga0265342_10020204 Ga0265342_100202044 598
28 3300042015 Ga0439462_0001110 Ga0439462_0001110_1872_3833 599
29 3300042156 Ga0439446_0002224 Ga0439446_0002224_1382_3343 599
30 3300045051 Ga0451576_0019405 Ga0451576_0019405_4716_6611 602
31 3300050511 nmdc:mga08y16_242737_c1 nmdc:mga08y16_242737_c1_13_1830 602
32 3300031733 Ga0316577_10012877 Ga0316577_100128771 603
33 3300036647 Ga0316582_0001368 Ga0316582_0001368_771_2648 603
34 3300036712 Ga0316584_0000553 Ga0316584_0000553_13664_15541 603
35 iso_pu_bacteria 2593339198 2595320120 603
36 3300039437 Ga0436365_1311032 Ga0436365_1311032_546_2498 607
37 3300049570 Ga0501033_0007254 Ga0501033_0007254_1160_3028 607
38 3300049579 Ga0501043_0020792 Ga0501043_0020792_3253_5121 607
39 3300049581 Ga0501047_0009903 Ga0501047_0009903_5982_7850 607
40 3300049822 Ga0501035_0029173 Ga0501035_0029173_2025_3893 607
41 3300049823 Ga0501044_0108544 Ga0501044_0108544_595_2463 607
42 iso_pu_bacteria 2856328259 2856332340 608
43 iso_pu_bacteria 2856334872 2856335694 608
44 iso_pu_bacteria 2857367948 2857370207 608
45 iso_pu_bacteria 2869264136 2869266472 608
46 iso_pu_bacteria 2869271264 2869274812 608
47 iso_pu_bacteria 2871459585 2871466599 608
48 iso_pu_bacteria 2874131515 2874134476 608
49 iso_pu_bacteria 2876399893 2876406335 608
50 iso_pu_bacteria 2878781027 2878786249 608
51 iso_pu_bacteria 2906363423 2906368371 608
52 iso_pu_bacteria 2906370794 2906372594 608
53 iso_pu_bacteria 2906393657 2906396133 608
54 iso_pu_bacteria 2922151315 2922153406 608
55 3300044712 Ga0453684_0024690 Ga0453684_0024690_2208_4064 611
56 3300053078 Ga0495612_0012484 Ga0495612_0012484_71_1927 613
57 3300037853 Ga0436364_0183340 Ga0436364_0183340_3447_5423 614
58 iso_pu_bacteria 2987673487 2987678943 616
59 3300042876 Ga0451577_0000896 Ga0451577_0000896_26603_28579 617
60 3300044712 Ga0453684_0002956 Ga0453684_0002956_15447_17423 617
61 3300005436 Ga0070713_100000669 Ga0070713_1000006696 619
62 3300044712 Ga0453684_0010985 Ga0453684_0010985_6934_8829 620
63 3300009147 Ga0114129_10099050 Ga0114129_100990502 621
64 3300037853 Ga0436364_0940001 Ga0436364_0940001_5948_7831 621
65 3300028666 Ga0265336_10007408 Ga0265336_100074083 624
66 3300028800 Ga0265338_10001840 Ga0265338_1000184013 624
67 iso_pu_bacteria 2878730984 2878737699 625
68 3300045051 Ga0451576_0002147 Ga0451576_0002147_428_2452 626
69 3300005536 Ga0070697_100006766 Ga0070697_1000067664 627
70 3300005614 Ga0068856_100046980 Ga0068856_1000469802 627
71 3300009093 Ga0105240_10005731 Ga0105240_1000573111 627
72 3300013104 Ga0157370_10035497 Ga0157370_100354973 627
73 3300013105 Ga0157369_10018490 Ga0157369_100184906 627
74 3300013307 Ga0157372_10012257 Ga0157372_100122575 627
75 3300025913 Ga0207695_10007239 Ga0207695_100072395 627
76 3300037466 Ga0395898_0015443 Ga0395898_0015443_903_2840 627
77 3300049822 Ga0501035_0002914 Ga0501035_0002914_6877_8823 629
78 3300049822 Ga0501035_0045705 Ga0501035_0045705_1820_3766 629
79 3300006844 Ga0075428_100057226 Ga0075428_1000572262 630
80 3300006846 Ga0075430_100016058 Ga0075430_1000160582 631
81 iso_pu_bacteria 2924733363 2924734229 631
82 iso_pu_bacteria 2756170246 2756677606 634
83 iso_pu_bacteria 2970489779 2970490010 634
84 3300044673 Ga0453683_0000520 Ga0453683_0000520_1067_3091 635
85 iso_pu_bacteria 2844009547 2844009812 635
86 iso_pu_bacteria 2869234852 2869236689 635
87 iso_pu_bacteria 2869256925 2869261996 635
88 iso_pu_bacteria 2874109183 2874111780 635
89 iso_pu_bacteria 2903513507 2903517358 635
90 iso_pu_bacteria 2968138860 2968142274 635
91 iso_pu_bacteria 2970510686 2970511247 635
92 iso_pu_bacteria 2970619444 2970621365 635
93 iso_pu_bacteria 2980182181 2980185887 635
94 iso_pu_bacteria 3004232784 3004238203 635
95 3300006844 Ga0075428_100136443 Ga0075428_1001364432 636
96 3300009094 Ga0111539_10004034 Ga0111539_100040346 636
97 3300049822 Ga0501035_0022669 Ga0501035_0022669_929_2887 636
98 3300049823 Ga0501044_0034729 Ga0501044_0034729_2232_4187 636
99 iso_pu_bacteria 2509276018 2509372111 636
100 iso_pu_bacteria 2513237090 2513611582 636
101 iso_pu_bacteria 2687453392 2688594943 636
102 iso_pu_bacteria 2961136820 2961143036 636
103 iso_pu_bacteria 2965025482 2965029147 636
104 iso_pu_bacteria 2965040258 2965041649 636
105 iso_pu_bacteria 2965089291 2965096334 636
106 iso_pu_bacteria 2965102966 2965110508 636
107 iso_pu_bacteria 2970547951 2970548312 636
108 iso_pu_bacteria 2977872689 2977873643 636
109 iso_pu_bacteria 2977915119 2977918590 636
110 iso_pu_bacteria 2977950692 2977951827 636
111 iso_pu_bacteria 2977957713 2977961374 636
112 iso_pu_bacteria 3004195979 3004202798 636
113 iso_pu_bacteria 3004239961 3004244073 636
114 iso_pu_bacteria 649633066 649865005 636
115 iso_pu_bacteria 8004361976 8004368084 636
116 3300028800 Ga0265338_10031906 Ga0265338_100319063 637
117 3300046660 Ga0495625_0007105 Ga0495625_0007105_1598_3577 637
118 iso_pu_bacteria 2958122699 2958125797 637
119 3300031242 Ga0265329_10004405 Ga0265329_100044054 639
120 3300031711 Ga0265314_10000389 Ga0265314_1000038918 639
121 3300044712 Ga0453684_0232644 Ga0453684_0232644_79_2007 640
122 3300005445 Ga0070708_100004192 Ga0070708_1000041924 641
123 3300005445 Ga0070708_100006229 Ga0070708_1000062297 641
124 3300005468 Ga0070707_100005921 Ga0070707_10000592110 641
125 3300005518 Ga0070699_100069982 Ga0070699_1000699821 641
126 3300009094 Ga0111539_10152489 Ga0111539_101524892 641
127 3300025910 Ga0207684_10007123 Ga0207684_100071236 641
128 3300025922 Ga0207646_10011222 Ga0207646_100112223 641
129 3300050511 nmdc:mga08y16_8664_c1 nmdc:mga08y16_8664_c1_7754_9745 641
130 3300050515 nmdc:mga0a205_22526_c1 nmdc:mga0a205_22526_c1_3631_5562 641
131 3300005343 Ga0070687_100036320 Ga0070687_1000363202 642
132 3300005365 Ga0070688_100013441 Ga0070688_1000134411 642
133 3300005544 Ga0070686_100007748 Ga0070686_1000077485 642
134 3300050508 nmdc:mga09592_34790_c1 nmdc:mga09592_34790_c1_950_2890 642
135 3300006852 Ga0075433_10045872 Ga0075433_100458723 643
136 3300006871 Ga0075434_100074308 Ga0075434_1000743083 643
137 3300009094 Ga0111539_10140755 Ga0111539_101407552 643
138 3300006844 Ga0075428_100032256 Ga0075428_1000322562 645
139 3300009094 Ga0111539_10047830 Ga0111539_100478304 645
140 3300045051 Ga0451576_0023607 Ga0451576_0023607_2394_4391 651
141 3300006871 Ga0075434_100069478 Ga0075434_1000694781 652
142 3300010375 Ga0105239_10004379 Ga0105239_100043794 659
143 3300005327 Ga0070658_10000096 Ga0070658_1000009651 672
144 3300005563 Ga0068855_100070725 Ga0068855_1000707252 672
145 3300025909 Ga0207705_10000141 Ga0207705_1000014151 672

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ov4-assembly2.cif.gz_C crystal structure of ketosteroid isomerase p39gv40gs42g from pseudomonas testosteroni (tksi) bound to equilenin 0.7788 63 101
3mki-assembly2.cif.gz_C crystal structure of ketosteroid isomerase d38ed99n from pseudomonas testosteroni (tksi) 0.7775 63 101
3myt-assembly4.cif.gz_C-2 crystal structure of ketosteroid isomerase d38hd99n from pseudomonas testosteroni (tksi) 0.7765 63 101
1ohs-assembly2.cif.gz_D crystal structure of 5-3-ketosteroid isomerase mutant y14f/d38n from pseudomonas testosteroni complexed with androstanedione 0.7674 63 101
3ov4-assembly2.cif.gz_D crystal structure of ketosteroid isomerase p39gv40gs42g from pseudomonas testosteroni (tksi) bound to equilenin 0.7653 63 101
ID Description Score Start End Superfamily
3a6oA04 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.8513 584 669 2.60.40.1180
af_B4FWN0_8_135_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8338 63 101 3.10.450.50
5a2cA02 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.8134 583 671 2.60.40.1180
1smaB04 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.8034 573 672 2.60.40.1180
1ji1A03 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.7952 584 670 2.60.40.1180
ID Description Score Start End GO Terms
AF-A0A659V1E2-F1-model_v4 Uncharacterized protein 0.9618 18 213
AF-A0A3D2RH52-F1-model_v4 Uncharacterized protein 0.9591 11 182
AF-X1UBK7-F1-model_v4 Uncharacterized protein 0.9557 288 559
AF-A0A3C2CY71-F1-model_v4 Uncharacterized protein 0.9526 19 672
AF-A0A3S1NK52-F1-model_v4 deleted 0.9513 102 228

Feature Viewer

pLDDT pTM Quality
85.31 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map