F192305

General Info

Members Datasets Scaffolds Average Seq Length
144 42 142 362

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0002743|Ga0316574_0002743_1497_2732
Length 411
Sequence VPRPSGLWQKFRNTPQLAAGIGILAFRQLSGIAAFNKIVKRFYFAWRKAMKENRIYNFNAGPAALPLEVLEEIKDSFLNFGDSGMSITEISHRSALFDDVINDAVARTRRLLKLDDRFHVLFIQGGASMQFCMIPMNLLGPSDTADYVNTGTWSTKAIKEAEILGKTISVAASSEDKNFSYIPKNIPFNKKAVYIHITSNNTIKGTQWASFPETGGVPLIADMSSDIMSRPFDAGKFGLIYAGAQKNIGPAGVCMVIIRDDLLKRVPDKLPSMLKYTTYATKNSMFNTPPCFTVYMIQLVLKWLEETVGGLEKMEQINQKKARMLYEAIDAGEFYHGTAETASRSIMNVTFRLPNETLEKQFVEQALKNGLGGLKGHRSVGGCRASIYNATSLEAVEALVDFMKTFAQTNG

Samples

Sample ID Description Type Environment
1 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
2 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
3 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
4 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
5 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
6 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
7 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
8 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
9 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
10 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
11 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
12 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
13 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
18 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
19 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
20 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
21 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
22 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
23 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
24 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
25 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
26 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
27 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
28 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
29 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
30 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
31 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
32 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
33 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
34 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
35 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
36 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
37 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
38 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
39 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
40 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
41 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
42 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.44
Metatranscriptomes 4.17
Isolates 1.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 1.39
Rhizoplane 0
Rhizosphere 72.22
Stem 0
Stem Tuber 0
Unclassified 26.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209281_1000051 3300027111 Bacteria 319152
2 Ga0209281_1000169 3300027111 Bacteria 154679
3 Ga0265338_10000711 3300028800 Bacteria 56880
4 Ga0316575_10000464 3300031665 Bacteria 11628
5 Ga0316575_10015575 3300031665 Bacteria 2867
6 Ga0316575_10016103 3300031665 Bacteria 2825
7 Ga0316575_10020811 3300031665 Bacteria 2519
8 Ga0316575_10021511 3300031665 Bacteria 2483
9 Ga0316575_10049551 3300031665 Unclassified 1671
10 Ga0316579_10001760 3300031691 Bacteria 7967
11 Ga0316579_10003832 3300031691 Bacteria 5927
12 Ga0316579_10048826 3300031691 Bacteria 1977
13 Ga0316579_10056495 3300031691 Bacteria 1842
14 Ga0316576_10000509 3300031727 Bacteria 18251
15 Ga0316576_10001572 3300031727 Bacteria 12406
16 Ga0316576_10010991 3300031727 Bacteria 5906
17 Ga0316576_10011943 3300031727 Bacteria 5715
18 Ga0316576_10016970 3300031727 Bacteria 4936
19 Ga0316576_10021182 3300031727 Bacteria 4491
20 Ga0316576_10027249 3300031727 Bacteria 4016
21 Ga0316576_10028189 3300031727 Bacteria 3956
22 Ga0316576_10032875 3300031727 Bacteria 3689
23 Ga0316576_10068110 3300031727 Bacteria 2621
24 Ga0316576_10073733 3300031727 Bacteria 2522
25 Ga0316576_10097681 3300031727 Bacteria 2193
26 Ga0316576_10164121 3300031727 Bacteria 1676
27 Ga0316576_10166214 3300031727 Unclassified 1665
28 Ga0316578_10001236 3300031728 Bacteria 10184
29 Ga0316578_10001602 3300031728 Bacteria 9344
30 Ga0316578_10016613 3300031728 Bacteria 3987
31 Ga0316578_10023074 3300031728 Bacteria 3479
32 Ga0316578_10029328 3300031728 Bacteria 3122
33 Ga0316578_10048813 3300031728 Bacteria 2472
34 Ga0316578_10098097 3300031728 Bacteria 1755
35 Ga0316578_10199486 3300031728 Bacteria 1205
36 Ga0316577_10018561 3300031733 Bacteria 3847
37 Ga0316577_10053707 3300031733 Unclassified 2248
38 Ga0316577_10082368 3300031733 Bacteria 1800
39 Ga0316577_10082467 3300031733 Bacteria 1798
40 Ga0316577_10129090 3300031733 Bacteria 1422
41 Ga0316583_10005328 3300032133 Bacteria 4613
42 Ga0316583_10005855 3300032133 Bacteria 4421
43 Ga0316583_10008034 3300032133 Bacteria 3801
44 Ga0316583_10008142 3300032133 Bacteria 3777
45 Ga0316583_10014994 3300032133 Bacteria 2789
46 Ga0316585_10000157 3300032137 Bacteria 13574
47 Ga0316585_10004156 3300032137 Bacteria 4020
48 Ga0316585_10028429 3300032137 Bacteria 1748
49 Ga0316580_10004970 3300032139 Bacteria 3867
50 Ga0316580_10011520 3300032139 Bacteria 2685
51 Ga0316580_10022814 3300032139 Bacteria 1931
52 Ga0316593_10001223 3300032168 Bacteria 5530
53 Ga0316592_1026609 3300033524 Bacteria 1249
54 Ga0316592_1026849 3300033524 Bacteria 1244
55 Ga0316588_1032051 3300033528 Bacteria 1235
56 Ga0316588_1033418 3300033528 Bacteria 1213
57 Ga0316596_1033408 3300033541 Bacteria 1340
58 Ga0316574_0002743 3300035398 Bacteria 8928
59 Ga0316574_0021081 3300035398 Bacteria 3864
60 Ga0316574_0023790 3300035398 Bacteria 3660
61 Ga0316574_0035915 3300035398 Bacteria 3031
62 Ga0316574_0073777 3300035398 Bacteria 2158
63 Ga0316574_0099694 3300035398 Bacteria 1858
64 Ga0316574_0117687 3300035398 Bacteria 1705
65 Ga0316574_0123756 3300035398 Unclassified 1661
66 Ga0316582_0016646 3300036647 Bacteria 4233
67 Ga0316582_0024351 3300036647 Unclassified 3622
68 Ga0316582_0030376 3300036647 Bacteria 3291
69 Ga0316582_0056819 3300036647 Bacteria 2498
70 Ga0316582_0057774 3300036647 Bacteria 2479
71 Ga0316582_0086049 3300036647 Bacteria 2061
72 Ga0316582_0104880 3300036647 Bacteria 1876
73 Ga0316582_0140872 3300036647 Bacteria 1626
74 Ga0316584_0003710 3300036712 Bacteria 9996
75 Ga0316584_0003806 3300036712 Bacteria 9891
76 Ga0316584_0008177 3300036712 Bacteria 7192
77 Ga0316584_0017156 3300036712 Bacteria 5200
78 Ga0316584_0023101 3300036712 Bacteria 4541
79 Ga0316584_0043916 3300036712 Bacteria 3333
80 Ga0316584_0052366 3300036712 Bacteria 3052
81 Ga0316584_0053322 3300036712 Bacteria 3026
82 Ga0316584_0081553 3300036712 Bacteria 2423
83 Ga0316584_0098048 3300036712 Bacteria 2194
84 Ga0316581_0008558 3300037588 Bacteria 2788
85 Ga0316581_0032367 3300037588 Bacteria 1577
86 Ga0436364_0572876 3300037853 Bacteria 1255
87 Ga0400484_02557 3300038725 Bacteria 3451
88 Ga0400484_05725 3300038725 Bacteria 6476
89 Ga0400484_17858 3300038725 Bacteria 7694
90 Ga0400490_37028 3300038726 Bacteria 13230
91 Ga0400490_59117 3300038726 Bacteria 41119
92 Ga0400491_02185 3300038727 Bacteria 2012
93 Ga0400491_13985 3300038727 Bacteria 2664
94 Ga0400491_15303 3300038727 Bacteria 3760
95 Ga0400485_00256 3300038735 Bacteria 5713
96 Ga0400485_10181 3300038735 Bacteria 11665
97 Ga0400488_06524 3300038741 Bacteria 1740
98 Ga0400488_32173 3300038741 Bacteria 10474
99 Ga0400488_47104 3300038741 Bacteria 11199
100 Ga0400488_55167 3300038741 Bacteria 12121
101 Ga0400488_55672 3300038741 Bacteria 2212
102 Ga0400488_56914 3300038741 Bacteria 1885
103 Ga0400488_60055 3300038741 Bacteria 2208
104 Ga0400486_02226 3300038742 Bacteria 15002
105 Ga0400486_08790 3300038742 Bacteria 10007
106 Ga0400486_22976 3300038742 Bacteria 93315
107 Ga0400486_25324 3300038742 Bacteria 1236
108 Ga0400483_130907 3300039062 Bacteria 1594
109 Ga0400483_137843 3300039062 Bacteria 2730
110 Ga0400483_144314 3300039062 Bacteria 5347
111 Ga0400483_208884 3300039062 Bacteria 74789
112 Ga0400483_247398 3300039062 Bacteria 2496
113 Ga0400489_11587 3300039093 Bacteria 8029
114 Ga0400489_24371 3300039093 Bacteria 12754
115 Ga0400489_40873 3300039093 Bacteria 16157
116 Ga0400489_63543 3300039093 Bacteria 130825
117 Ga0400489_90809 3300039093 Bacteria 20585
118 Ga0400487_14913 3300039110 Bacteria 3923
119 Ga0400487_31484 3300039110 Bacteria 2014
120 Ga0400487_50601 3300039110 Bacteria 39607
121 Ga0451855_1308216 3300041511 Bacteria 1557
122 Ga0451577_0000181 3300042876 Bacteria 134503
123 Ga0451577_0086671 3300042876 Bacteria 2793
124 Ga0453683_0000784 3300044673 Bacteria 31467
125 Ga0453683_0005306 3300044673 Bacteria 9014
126 Ga0453683_0022414 3300044673 Bacteria 4029
127 Ga0453683_0065567 3300044673 Bacteria 2270
128 Ga0453683_0148866 3300044673 Bacteria 1479
129 Ga0453684_0000592 3300044712 Bacteria 134503
130 Ga0453684_0002577 3300044712 Bacteria 43470
131 Ga0453684_0103040 3300044712 Bacteria 3488
132 Ga0453684_0191915 3300044712 Bacteria 2389
133 Ga0453684_0406817 3300044712 Bacteria 1523
134 Ga0451576_0058662 3300045051 Unclassified 4021
135 Ga0451576_0066416 3300045051 Bacteria 3756
136 Ga0495580_0000462 3300046472 Bacteria 33735
137 Ga0501034_0019010 3300049571 Bacteria 7038
138 Ga0501042_0064482 3300049578 Bacteria 2618
139 Ga0501071_0059388 3300049587 Bacteria 2767
140 Ga0501076_0071690 3300049592 Bacteria 2772
141 Ga0590071_020911 3300059421 Bacteria 1542
142 Ga0590077_019005 3300059426 Bacteria 1453

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_0572876 Ga0436364_0572876_342_1244 298
2 3300042876 Ga0451577_0000181 Ga0451577_0000181_32617_33654 343
3 3300044712 Ga0453684_0000592 Ga0453684_0000592_100850_101887 343
4 3300044673 Ga0453683_0022414 Ga0453683_0022414_779_1822 346
5 iso_pu_bacteria 2808606364 2808870295 351
6 3300059421 Ga0590071_020911 Ga0590071_020911_238_1305 352
7 3300059426 Ga0590077_019005 Ga0590077_019005_189_1256 352
8 3300044673 Ga0453683_0148866 Ga0453683_0148866_228_1310 354
9 3300049571 Ga0501034_0019010 Ga0501034_0019010_4976_6058 354
10 3300038726 Ga0400490_37028 Ga0400490_37028_5994_7064 355
11 iso_pu_bacteria 2740891818 2740990443 355
12 3300031733 Ga0316577_10129090 Ga0316577_101290902 356
13 3300036647 Ga0316582_0140872 Ga0316582_0140872_225_1310 356
14 3300036712 Ga0316584_0043916 Ga0316584_0043916_891_1976 356
15 3300038727 Ga0400491_15303 Ga0400491_15303_1557_2636 356
16 3300038735 Ga0400485_10181 Ga0400485_10181_1739_2818 356
17 3300038741 Ga0400488_56914 Ga0400488_56914_684_1763 356
18 3300038742 Ga0400486_22976 Ga0400486_22976_91238_92317 356
19 3300039093 Ga0400489_24371 Ga0400489_24371_10946_12025 356
20 3300039110 Ga0400487_31484 Ga0400487_31484_186_1301 356
21 3300039110 Ga0400487_50601 Ga0400487_50601_1083_2162 356
22 3300049578 Ga0501042_0064482 Ga0501042_0064482_767_1849 356
23 3300049587 Ga0501071_0059388 Ga0501071_0059388_181_1263 356
24 3300049592 Ga0501076_0071690 Ga0501076_0071690_618_1700 356
25 3300031665 Ga0316575_10000464 Ga0316575_1000046413 357
26 3300031665 Ga0316575_10015575 Ga0316575_100155752 357
27 3300031665 Ga0316575_10020811 Ga0316575_100208112 357
28 3300031665 Ga0316575_10021511 Ga0316575_100215112 357
29 3300031665 Ga0316575_10049551 Ga0316575_100495511 357
30 3300031691 Ga0316579_10001760 Ga0316579_100017606 357
31 3300031691 Ga0316579_10003832 Ga0316579_100038323 357
32 3300031691 Ga0316579_10048826 Ga0316579_100488262 357
33 3300031691 Ga0316579_10056495 Ga0316579_100564952 357
34 3300031727 Ga0316576_10000509 Ga0316576_100005092 357
35 3300031727 Ga0316576_10001572 Ga0316576_100015729 357
36 3300031727 Ga0316576_10010991 Ga0316576_100109912 357
37 3300031727 Ga0316576_10011943 Ga0316576_100119436 357
38 3300031727 Ga0316576_10021182 Ga0316576_100211823 357
39 3300031727 Ga0316576_10028189 Ga0316576_100281894 357
40 3300031727 Ga0316576_10032875 Ga0316576_100328752 357
41 3300031727 Ga0316576_10068110 Ga0316576_100681101 357
42 3300031727 Ga0316576_10097681 Ga0316576_100976812 357
43 3300031727 Ga0316576_10164121 Ga0316576_101641212 357
44 3300031727 Ga0316576_10166214 Ga0316576_101662142 357
45 3300031728 Ga0316578_10001236 Ga0316578_100012363 357
46 3300031728 Ga0316578_10016613 Ga0316578_100166132 357
47 3300031728 Ga0316578_10023074 Ga0316578_100230742 357
48 3300031728 Ga0316578_10029328 Ga0316578_100293282 357
49 3300031728 Ga0316578_10048813 Ga0316578_100488132 357
50 3300031728 Ga0316578_10098097 Ga0316578_100980971 357
51 3300031728 Ga0316578_10199486 Ga0316578_101994861 357
52 3300031733 Ga0316577_10018561 Ga0316577_100185613 357
53 3300031733 Ga0316577_10053707 Ga0316577_100537072 357
54 3300031733 Ga0316577_10082368 Ga0316577_100823682 357
55 3300031733 Ga0316577_10082467 Ga0316577_100824672 357
56 3300032133 Ga0316583_10005328 Ga0316583_100053281 357
57 3300032133 Ga0316583_10005855 Ga0316583_100058552 357
58 3300032133 Ga0316583_10008034 Ga0316583_100080342 357
59 3300032133 Ga0316583_10014994 Ga0316583_100149942 357
60 3300032137 Ga0316585_10000157 Ga0316585_100001579 357
61 3300032137 Ga0316585_10004156 Ga0316585_100041562 357
62 3300032137 Ga0316585_10028429 Ga0316585_100284291 357
63 3300032139 Ga0316580_10004970 Ga0316580_100049702 357
64 3300032139 Ga0316580_10011520 Ga0316580_100115202 357
65 3300032139 Ga0316580_10022814 Ga0316580_100228141 357
66 3300032168 Ga0316593_10001223 Ga0316593_100012233 357
67 3300033524 Ga0316592_1026609 Ga0316592_10266091 357
68 3300033528 Ga0316588_1033418 Ga0316588_10334182 357
69 3300033541 Ga0316596_1033408 Ga0316596_10334082 357
70 3300035398 Ga0316574_0002743 Ga0316574_0002743_1497_2732 357
71 3300035398 Ga0316574_0021081 Ga0316574_0021081_2541_3629 357
72 3300035398 Ga0316574_0023790 Ga0316574_0023790_1908_2999 357
73 3300035398 Ga0316574_0035915 Ga0316574_0035915_1356_2447 357
74 3300035398 Ga0316574_0073777 Ga0316574_0073777_226_1314 357
75 3300035398 Ga0316574_0099694 Ga0316574_0099694_369_1460 357
76 3300035398 Ga0316574_0123756 Ga0316574_0123756_506_1591 357
77 3300036647 Ga0316582_0016646 Ga0316582_0016646_2463_3554 357
78 3300036647 Ga0316582_0024351 Ga0316582_0024351_528_1616 357
79 3300036647 Ga0316582_0030376 Ga0316582_0030376_1461_2552 357
80 3300036647 Ga0316582_0056819 Ga0316582_0056819_539_1630 357
81 3300036647 Ga0316582_0057774 Ga0316582_0057774_502_1641 357
82 3300036647 Ga0316582_0086049 Ga0316582_0086049_227_1315 357
83 3300036712 Ga0316584_0003710 Ga0316584_0003710_6155_7243 357
84 3300036712 Ga0316584_0008177 Ga0316584_0008177_4721_5806 357
85 3300036712 Ga0316584_0017156 Ga0316584_0017156_4014_5189 357
86 3300036712 Ga0316584_0023101 Ga0316584_0023101_302_1390 357
87 3300036712 Ga0316584_0052366 Ga0316584_0052366_1914_3014 357
88 3300036712 Ga0316584_0053322 Ga0316584_0053322_1561_2652 357
89 3300036712 Ga0316584_0081553 Ga0316584_0081553_172_1257 357
90 3300036712 Ga0316584_0098048 Ga0316584_0098048_759_1850 357
91 3300037588 Ga0316581_0008558 Ga0316581_0008558_487_1572 357
92 3300037588 Ga0316581_0032367 Ga0316581_0032367_303_1388 357
93 3300038725 Ga0400484_02557 Ga0400484_02557_613_1701 357
94 3300038725 Ga0400484_05725 Ga0400484_05725_4152_5255 357
95 3300038725 Ga0400484_17858 Ga0400484_17858_4563_5651 357
96 3300038726 Ga0400490_59117 Ga0400490_59117_39123_40211 357
97 3300038727 Ga0400491_02185 Ga0400491_02185_181_1269 357
98 3300038727 Ga0400491_13985 Ga0400491_13985_690_1778 357
99 3300038735 Ga0400485_00256 Ga0400485_00256_4421_5509 357
100 3300038741 Ga0400488_06524 Ga0400488_06524_564_1652 357
101 3300038741 Ga0400488_32173 Ga0400488_32173_9308_10396 357
102 3300038741 Ga0400488_47104 Ga0400488_47104_6116_7204 357
103 3300038741 Ga0400488_55167 Ga0400488_55167_6073_7161 357
104 3300038741 Ga0400488_55672 Ga0400488_55672_906_2009 357
105 3300038742 Ga0400486_02226 Ga0400486_02226_3434_4522 357
106 3300038742 Ga0400486_08790 Ga0400486_08790_7216_8412 357
107 3300038742 Ga0400486_25324 Ga0400486_25324_132_1217 357
108 3300039062 Ga0400483_137843 Ga0400483_137843_1309_2397 357
109 3300039062 Ga0400483_144314 Ga0400483_144314_932_2020 357
110 3300039062 Ga0400483_208884 Ga0400483_208884_20671_21759 357
111 3300039062 Ga0400483_247398 Ga0400483_247398_559_1647 357
112 3300039093 Ga0400489_11587 Ga0400489_11587_2213_3301 357
113 3300039093 Ga0400489_40873 Ga0400489_40873_4713_5801 357
114 3300039093 Ga0400489_63543 Ga0400489_63543_77531_78616 357
115 3300039093 Ga0400489_90809 Ga0400489_90809_6247_7335 357
116 3300044712 Ga0453684_0002577 Ga0453684_0002577_1720_2808 357
117 3300044712 Ga0453684_0103040 Ga0453684_0103040_695_1771 357
118 3300045051 Ga0451576_0058662 Ga0451576_0058662_1350_2435 357
119 3300028800 Ga0265338_10000711 Ga0265338_1000071136 358
120 3300031727 Ga0316576_10073733 Ga0316576_100737332 358
121 3300033524 Ga0316592_1026849 Ga0316592_10268491 358
122 3300038741 Ga0400488_60055 Ga0400488_60055_685_1767 358
123 3300039062 Ga0400483_130907 Ga0400483_130907_482_1567 358
124 3300039110 Ga0400487_14913 Ga0400487_14913_469_1551 358
125 3300042876 Ga0451577_0086671 Ga0451577_0086671_1227_2309 358
126 3300044673 Ga0453683_0000784 Ga0453683_0000784_8829_9911 358
127 3300044712 Ga0453684_0406817 Ga0453684_0406817_77_1159 358
128 3300031665 Ga0316575_10016103 Ga0316575_100161033 359
129 3300031727 Ga0316576_10016970 Ga0316576_100169705 359
130 3300031727 Ga0316576_10027249 Ga0316576_100272494 359
131 3300031728 Ga0316578_10001602 Ga0316578_100016026 359
132 3300032133 Ga0316583_10008142 Ga0316583_100081422 359
133 3300033528 Ga0316588_1032051 Ga0316588_10320511 359
134 3300035398 Ga0316574_0117687 Ga0316574_0117687_515_1600 359
135 3300036647 Ga0316582_0104880 Ga0316582_0104880_266_1351 359
136 3300036712 Ga0316584_0003806 Ga0316584_0003806_8731_9816 359
137 3300041511 Ga0451855_1308216 Ga0451855_1308216_294_1379 359
138 3300044673 Ga0453683_0005306 Ga0453683_0005306_2366_3454 359
139 3300044673 Ga0453683_0065567 Ga0453683_0065567_18_1106 359
140 3300044712 Ga0453684_0191915 Ga0453684_0191915_1154_2242 359
141 3300045051 Ga0451576_0066416 Ga0451576_0066416_91_1179 359
142 3300046472 Ga0495580_0000462 Ga0495580_0000462_20899_22002 359
143 3300027111 Ga0209281_1000051 Ga0209281_1000051248 360
144 3300027111 Ga0209281_1000169 Ga0209281_1000169100 360

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00266

Aminotran_5

Aminotransferase class-V

55

399

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6czz-assembly2.cif.gz_C crystal structure of arabidopsis thaliana phosphoserine aminotransferase isoform 1 (atpsat1) in complex with plp-phosphoserine geminal diamine intermediate 0.9807 2 360
2bi2-assembly1.cif.gz_A radiation damage of the schiff base in phosphoserine aminotransferase (structure c) 0.9786 1 358
2bi5-assembly1.cif.gz_B radiation damage of the schiff base in phosphoserine aminotransferase (structure e) 0.9785 2 358
1bt4-assembly1.cif.gz_A phosphoserine aminotransferase from bacillus circulans subsp. alkalophilus 0.977 1 360
4xk1-assembly1.cif.gz_B crystal structure of a phosphoserine/phosphohydroxythreonine aminotransferase (psat) from pseudomonas aeruginosa with cofactor pyridoxal phosphate and bound glutamate 0.9753 5 350
ID Description Score Start End Superfamily
1w23A02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9843 258 358 3.90.1150.10
af_I1J8D7_67_308_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9767 16 255 3.40.640.10
2bi2B01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9708 18 256 3.40.640.10
3qm2B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.97 258 360 3.90.1150.10
af_Q55CQ6_268_374_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9688 257 360 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A357GRY6-F1-model_v4 deleted 0.9965 13 325
AF-F7JJ21-F1-model_v4 Phosphoserine aminotransferase (EC 2.6.1.52) (Phosphohydroxythreonine aminotransferase) (PSAT) 0.9964 34 360 GO:0004648
GO:0005737
GO:0006564
GO:0030170
AF-A0A496T3S4-F1-model_v4 Phosphoserine aminotransferase (Phosphohydroxythreonine aminotransferase) 0.9955 258 360 GO:0004648
GO:0005737
GO:0006564
GO:0030170
AF-R7EA40-F1-model_v4 deleted 0.9954 1 360
AF-A0A3D2PUL9-F1-model_v4 Phosphoserine aminotransferase (Phosphohydroxythreonine aminotransferase) 0.9944 236 360 GO:0004648
GO:0005737
GO:0006564
GO:0030170

Feature Viewer

pLDDT pTM Quality
95.26 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map