F191191

General Info

Members Datasets Scaffolds Average Seq Length
144 92 140 156

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100102242|Ga0068855_1001022422
Length 174
Sequence LEFGTFKMHIVLVEPEIPPNTGNVARLCAATRSTLHLIEPFGFKLDDAQLKRAGMDYWQHVEWHRWKNWTALAQSLPPAARVWFVESDGPTLYSDAKFSANDYIVFGRETAGLPKQLLEQNRERWLRIPMFNSNARSLNLSNCVALVLFEALRQNGFAGEMGTSNAQHPTSDIQ

Samples

Sample ID Description Type Environment
1 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
2 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
3 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
48 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
49 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
50 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
51 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
52 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
55 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
56 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
57 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
58 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
59 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
60 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
64 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
68 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
69 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
77 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
78 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
79 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
80 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
81 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
82 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
83 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
90 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
91 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
92 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.22
Metatranscriptomes 0
Isolates 2.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 1.39
Rhizosphere 94.44
Stem 0
Stem Tuber 0
Unclassified 3.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10119522 3300003320 Unclassified 2907
2 rootH1_10343538 3300003323 Unclassified 1037
3 Ga0070658_10535465 3300005327 Bacteria 1013
4 Ga0068869_101347027 3300005334 Bacteria 631
5 Ga0070691_10014612 3300005341 Bacteria 3603
6 Ga0070687_100217239 3300005343 Unclassified 1168
7 Ga0070714_101178839 3300005435 Bacteria 747
8 Ga0070713_101431472 3300005436 Bacteria 670
9 Ga0070700_100270806 3300005441 Bacteria 1227
10 Ga0070694_100455136 3300005444 Bacteria 1011
11 Ga0070681_10095260 3300005458 Bacteria 2925
12 Ga0068853_100133382 3300005539 Bacteria 2225
13 Ga0068853_100473645 3300005539 Bacteria 1180
14 Ga0068855_100102242 3300005563 Bacteria 3298
15 Ga0068855_100197388 3300005563 Bacteria 2267
16 Ga0068855_101155728 3300005563 Bacteria 807
17 Ga0068857_100019671 3300005577 Bacteria 5931
18 Ga0068857_101026854 3300005577 Unclassified 794
19 Ga0068856_100077870 3300005614 Bacteria 3286
20 Ga0068856_101572652 3300005614 Unclassified 671
21 Ga0068859_100640694 3300005617 Unclassified 1155
22 Ga0068863_100642313 3300005841 Bacteria 1052
23 Ga0097621_100642725 3300006237 Bacteria 973
24 Ga0068871_100123755 3300006358 Bacteria 2187
25 Ga0097620_100640550 3300006931 Unclassified 1155
26 Ga0105240_10016892 3300009093 Bacteria 9864
27 Ga0105240_10090775 3300009093 Bacteria 3733
28 Ga0105240_10750946 3300009093 Bacteria 1061
29 Ga0105240_11329696 3300009093 Bacteria 757
30 Ga0105245_10236193 3300009098 Bacteria 1770
31 Ga0105248_10179170 3300009177 Bacteria 2388
32 Ga0105238_10007385 3300009551 Bacteria 11011
33 Ga0105238_10179995 3300009551 Bacteria 2091
34 Ga0105238_10266471 3300009551 Unclassified 1693
35 Ga0105239_12350916 3300010375 Bacteria 620
36 Ga0157370_10208235 3300013104 Bacteria 1813
37 Ga0157369_10566721 3300013105 Bacteria 1173
38 Ga0157374_10599873 3300013296 Bacteria 1111
39 Ga0157378_10205680 3300013297 Bacteria 1864
40 Ga0157378_10231122 3300013297 Unclassified 1762
41 Ga0157372_10369563 3300013307 Bacteria 1671
42 Ga0157372_11279339 3300013307 Bacteria 847
43 Ga0157372_11565504 3300013307 Bacteria 759
44 Ga0163163_10127365 3300014325 Unclassified 2585
45 Ga0207707_10069716 3300025912 Bacteria 3064
46 Ga0207707_10788878 3300025912 Unclassified 792
47 Ga0207695_10087297 3300025913 Bacteria 3142
48 Ga0207695_10215488 3300025913 Bacteria 1829
49 Ga0207660_10646703 3300025917 Bacteria 862
50 Ga0207694_10067883 3300025924 Bacteria 2784
51 Ga0207694_10222836 3300025924 Unclassified 1539
52 Ga0207664_11182553 3300025929 Bacteria 682
53 Ga0207711_10689457 3300025941 Bacteria 953
54 Ga0207689_10294891 3300025942 Bacteria 1344
55 Ga0207661_10976958 3300025944 Bacteria 780
56 Ga0207667_10235820 3300025949 Bacteria 1873
57 Ga0207667_10271439 3300025949 Bacteria 1734
58 Ga0207667_10272671 3300025949 Unclassified 1729
59 Ga0207667_10658371 3300025949 Bacteria 1052
60 Ga0207639_10227781 3300026041 Bacteria 1614
61 Ga0207708_11233358 3300026075 Bacteria 654
62 Ga0207674_10027996 3300026116 Bacteria 5955
63 Ga0207674_10809463 3300026116 Unclassified 904
64 Ga0265326_10001441 3300028558 Bacteria 8378
65 Ga0265319_1014261 3300028563 Unclassified 3124
66 Ga0265319_1166013 3300028563 Unclassified 681
67 Ga0265334_10003913 3300028573 Bacteria 6707
68 Ga0265323_10000225 3300028653 Bacteria 33236
69 Ga0265323_10028099 3300028653 Bacteria 2110
70 Ga0265323_10055464 3300028653 Bacteria 1393
71 Ga0265323_10064723 3300028653 Bacteria 1263
72 Ga0265322_10030244 3300028654 Unclassified 1547
73 Ga0265322_10045680 3300028654 Bacteria 1246
74 Ga0265336_10086834 3300028666 Bacteria 933
75 Ga0265338_10000040 3300028800 Bacteria 232041
76 Ga0265338_10000064 3300028800 Bacteria 190219
77 Ga0265338_10001028 3300028800 Bacteria 46692
78 Ga0265338_10001719 3300028800 Bacteria 34724
79 Ga0265338_10004514 3300028800 Bacteria 18770
80 Ga0265338_10004793 3300028800 Bacteria 18078
81 Ga0265338_10011330 3300028800 Bacteria 10316
82 Ga0265338_10063570 3300028800 Unclassified 3217
83 Ga0265338_10084568 3300028800 Unclassified 2648
84 Ga0265338_10120212 3300028800 Bacteria 2095
85 Ga0265338_10321743 3300028800 Bacteria 1119
86 Ga0265324_10000392 3300029957 Bacteria 31749
87 Ga0265324_10022144 3300029957 Bacteria 2274
88 Ga0265324_10031922 3300029957 Bacteria 1842
89 Ga0265324_10034717 3300029957 Unclassified 1756
90 Ga0265330_10094571 3300031235 Bacteria 1281
91 Ga0265328_10265326 3300031239 Bacteria 659
92 Ga0265320_10103494 3300031240 Bacteria 1310
93 Ga0265320_10273221 3300031240 Bacteria 748
94 Ga0265325_10015157 3300031241 Bacteria 4341
95 Ga0265339_10020732 3300031249 Bacteria 3836
96 Ga0265339_10093748 3300031249 Bacteria 1570
97 Ga0265339_10155531 3300031249 Bacteria 1153
98 Ga0265331_10117597 3300031250 Bacteria 1216
99 Ga0265327_10001576 3300031251 Bacteria 27857
100 Ga0265316_10016502 3300031344 Bacteria 6401
101 Ga0265316_10028190 3300031344 Bacteria 4635
102 Ga0265316_10034790 3300031344 Bacteria 4090
103 Ga0265316_10172203 3300031344 Bacteria 1614
104 Ga0265316_10369367 3300031344 Bacteria 1036
105 Ga0307509_10605480 3300031507 Bacteria 768
106 Ga0265313_10008869 3300031595 Bacteria 6619
107 Ga0265314_10027600 3300031711 Bacteria 4250
108 Ga0265314_10089587 3300031711 Unclassified 2006
109 Ga0265314_10127221 3300031711 Bacteria 1594
110 Ga0265314_10171119 3300031711 Bacteria 1311
111 Ga0265342_10067803 3300031712 Unclassified 2087
112 Ga0265342_10347098 3300031712 Bacteria 774
113 Ga0373954_0014987 3300035118 Bacteria 3461
114 Ga0373956_0165012 3300035119 Bacteria 1044
115 Ga0373933_0086346 3300035724 Bacteria 1931
116 Ga0395905_0746724 3300037471 Bacteria 881
117 Ga0395901_1333837 3300038443 Bacteria 678
118 Ga0451577_0419715 3300042876 Unclassified 1215
119 Ga0453684_0581524 3300044712 Bacteria 1230
120 Ga0453684_1266807 3300044712 Unclassified 771
121 Ga0451576_0527670 3300045051 Bacteria 1240
122 Ga0451576_1963181 3300045051 Bacteria 603
123 Ga0495653_0233516 3300046463 Bacteria 1230
124 Ga0495618_0082273 3300046514 Bacteria 2056
125 Ga0495667_0623488 3300046559 Bacteria 671
126 Ga0495624_0765613 3300046690 Bacteria 571
127 Ga0495604_0795440 3300047317 Bacteria 596
128 Ga0495675_0134891 3300047444 Bacteria 1533
129 Ga0496107_0448403 3300048910 Bacteria 959
130 Ga0496115_0040977 3300048918 Bacteria 3683
131 Ga0501032_0028155 3300049569 Bacteria 3861
132 Ga0501033_0045144 3300049570 Bacteria 3280
133 Ga0501033_0082541 3300049570 Bacteria 2356
134 Ga0501037_0209257 3300049573 Bacteria 1376
135 Ga0501039_0273012 3300049575 Bacteria 1329
136 Ga0501046_0070767 3300049580 Bacteria 2712
137 Ga0501035_0127836 3300049822 Bacteria 2217
138 Ga0501044_1555382 3300049823 Unclassified 526
139 nmdc:mga08y16_407704_c1 3300050511 Bacteria 1390
140 Ga0500650_0041990 3300053098 Unclassified 2112

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028800 Ga0265338_10084568 Ga0265338_100845684 140
2 iso_pu_bacteria 2808606364 2808868042 140
3 iso_pu_bacteria 2964375228 2964376671 140
4 iso_pu_bacteria 2881644220 2881645242 141
5 iso_pu_bacteria 8007371054 8007373777 141
6 3300005441 Ga0070700_100270806 Ga0070700_1002708062 142
7 3300005617 Ga0068859_100640694 Ga0068859_1006406942 142
8 3300006931 Ga0097620_100640550 Ga0097620_1006405502 142
9 3300013297 Ga0157378_10231122 Ga0157378_102311223 142
10 3300037471 Ga0395905_0746724 Ga0395905_0746724_186_680 143
11 3300038443 Ga0395901_1333837 Ga0395901_1333837_65_559 143
12 3300003323 rootH1_10343538 rootH1_103435382 144
13 3300005444 Ga0070694_100455136 Ga0070694_1004551362 144
14 3300005458 Ga0070681_10095260 Ga0070681_100952601 144
15 3300005577 Ga0068857_100019671 Ga0068857_1000196716 144
16 3300009093 Ga0105240_11329696 Ga0105240_113296961 144
17 3300009177 Ga0105248_10179170 Ga0105248_101791702 144
18 3300013296 Ga0157374_10599873 Ga0157374_105998732 144
19 3300014325 Ga0163163_10127365 Ga0163163_101273652 144
20 3300025912 Ga0207707_10069716 Ga0207707_100697162 144
21 3300025917 Ga0207660_10646703 Ga0207660_106467031 144
22 3300025941 Ga0207711_10689457 Ga0207711_106894572 144
23 3300026116 Ga0207674_10027996 Ga0207674_100279966 144
24 3300028558 Ga0265326_10001441 Ga0265326_1000144110 144
25 3300028563 Ga0265319_1014261 Ga0265319_10142612 144
26 3300028573 Ga0265334_10003913 Ga0265334_100039133 144
27 3300028653 Ga0265323_10028099 Ga0265323_100280994 144
28 3300028653 Ga0265323_10055464 Ga0265323_100554642 144
29 3300028653 Ga0265323_10064723 Ga0265323_100647232 144
30 3300028654 Ga0265322_10045680 Ga0265322_100456801 144
31 3300028666 Ga0265336_10086834 Ga0265336_100868342 144
32 3300028800 Ga0265338_10000064 Ga0265338_1000006460 144
33 3300028800 Ga0265338_10001719 Ga0265338_1000171910 144
34 3300028800 Ga0265338_10004793 Ga0265338_100047938 144
35 3300028800 Ga0265338_10120212 Ga0265338_101202123 144
36 3300028800 Ga0265338_10321743 Ga0265338_103217432 144
37 3300029957 Ga0265324_10022144 Ga0265324_100221442 144
38 3300029957 Ga0265324_10031922 Ga0265324_100319222 144
39 3300031235 Ga0265330_10094571 Ga0265330_100945712 144
40 3300031240 Ga0265320_10103494 Ga0265320_101034941 144
41 3300031240 Ga0265320_10273221 Ga0265320_102732212 144
42 3300031241 Ga0265325_10015157 Ga0265325_100151573 144
43 3300031249 Ga0265339_10093748 Ga0265339_100937483 144
44 3300031249 Ga0265339_10155531 Ga0265339_101555311 144
45 3300031250 Ga0265331_10117597 Ga0265331_101175972 144
46 3300031344 Ga0265316_10028190 Ga0265316_100281905 144
47 3300031344 Ga0265316_10172203 Ga0265316_101722032 144
48 3300031344 Ga0265316_10369367 Ga0265316_103693671 144
49 3300031595 Ga0265313_10008869 Ga0265313_100088695 144
50 3300031711 Ga0265314_10027600 Ga0265314_100276002 144
51 3300031711 Ga0265314_10089587 Ga0265314_100895872 144
52 3300031711 Ga0265314_10127221 Ga0265314_101272212 144
53 3300031711 Ga0265314_10171119 Ga0265314_101711191 144
54 3300031712 Ga0265342_10347098 Ga0265342_103470982 144
55 3300042876 Ga0451577_0419715 Ga0451577_0419715_381_860 144
56 3300044712 Ga0453684_0581524 Ga0453684_0581524_51_530 144
57 3300044712 Ga0453684_1266807 Ga0453684_1266807_164_628 144
58 3300050511 nmdc:mga08y16_407704_c1 nmdc:mga08y16_407704_c1_831_1295 144
59 3300003320 rootH2_10119522 rootH2_101195224 145
60 3300005327 Ga0070658_10535465 Ga0070658_105354653 145
61 3300005334 Ga0068869_101347027 Ga0068869_1013470271 145
62 3300005341 Ga0070691_10014612 Ga0070691_100146123 145
63 3300005343 Ga0070687_100217239 Ga0070687_1002172392 145
64 3300005435 Ga0070714_101178839 Ga0070714_1011788391 145
65 3300005436 Ga0070713_101431472 Ga0070713_1014314722 145
66 3300005539 Ga0068853_100133382 Ga0068853_1001333822 145
67 3300005539 Ga0068853_100473645 Ga0068853_1004736452 145
68 3300005563 Ga0068855_100102242 Ga0068855_1001022422 145
69 3300005563 Ga0068855_100197388 Ga0068855_1001973883 145
70 3300005563 Ga0068855_101155728 Ga0068855_1011557281 145
71 3300005577 Ga0068857_101026854 Ga0068857_1010268541 145
72 3300005614 Ga0068856_100077870 Ga0068856_1000778702 145
73 3300005614 Ga0068856_101572652 Ga0068856_1015726521 145
74 3300005841 Ga0068863_100642313 Ga0068863_1006423132 145
75 3300006237 Ga0097621_100642725 Ga0097621_1006427251 145
76 3300006358 Ga0068871_100123755 Ga0068871_1001237552 145
77 3300009093 Ga0105240_10016892 Ga0105240_100168924 145
78 3300009093 Ga0105240_10090775 Ga0105240_100907754 145
79 3300009093 Ga0105240_10750946 Ga0105240_107509462 145
80 3300009098 Ga0105245_10236193 Ga0105245_102361932 145
81 3300009551 Ga0105238_10007385 Ga0105238_100073859 145
82 3300009551 Ga0105238_10179995 Ga0105238_101799954 145
83 3300009551 Ga0105238_10266471 Ga0105238_102664714 145
84 3300010375 Ga0105239_12350916 Ga0105239_123509161 145
85 3300013104 Ga0157370_10208235 Ga0157370_102082351 145
86 3300013105 Ga0157369_10566721 Ga0157369_105667212 145
87 3300013297 Ga0157378_10205680 Ga0157378_102056802 145
88 3300013307 Ga0157372_10369563 Ga0157372_103695632 145
89 3300013307 Ga0157372_11279339 Ga0157372_112793392 145
90 3300013307 Ga0157372_11565504 Ga0157372_115655042 145
91 3300025912 Ga0207707_10788878 Ga0207707_107888781 145
92 3300025913 Ga0207695_10087297 Ga0207695_100872974 145
93 3300025913 Ga0207695_10215488 Ga0207695_102154882 145
94 3300025924 Ga0207694_10067883 Ga0207694_100678832 145
95 3300025924 Ga0207694_10222836 Ga0207694_102228362 145
96 3300025929 Ga0207664_11182553 Ga0207664_111825531 145
97 3300025942 Ga0207689_10294891 Ga0207689_102948911 145
98 3300025944 Ga0207661_10976958 Ga0207661_109769582 145
99 3300025949 Ga0207667_10235820 Ga0207667_102358201 145
100 3300025949 Ga0207667_10271439 Ga0207667_102714392 145
101 3300025949 Ga0207667_10272671 Ga0207667_102726712 145
102 3300025949 Ga0207667_10658371 Ga0207667_106583712 145
103 3300026041 Ga0207639_10227781 Ga0207639_102277812 145
104 3300026075 Ga0207708_11233358 Ga0207708_112333581 145
105 3300026116 Ga0207674_10809463 Ga0207674_108094632 145
106 3300028563 Ga0265319_1166013 Ga0265319_11660131 145
107 3300028653 Ga0265323_10000225 Ga0265323_100002259 145
108 3300028654 Ga0265322_10030244 Ga0265322_100302442 145
109 3300028800 Ga0265338_10000040 Ga0265338_1000004035 145
110 3300028800 Ga0265338_10001028 Ga0265338_1000102836 145
111 3300028800 Ga0265338_10004514 Ga0265338_1000451414 145
112 3300028800 Ga0265338_10011330 Ga0265338_100113306 145
113 3300028800 Ga0265338_10063570 Ga0265338_100635702 145
114 3300029957 Ga0265324_10000392 Ga0265324_1000039220 145
115 3300029957 Ga0265324_10034717 Ga0265324_100347172 145
116 3300031239 Ga0265328_10265326 Ga0265328_102653261 145
117 3300031249 Ga0265339_10020732 Ga0265339_100207323 145
118 3300031251 Ga0265327_10001576 Ga0265327_1000157622 145
119 3300031344 Ga0265316_10016502 Ga0265316_100165025 145
120 3300031344 Ga0265316_10034790 Ga0265316_100347905 145
121 3300031507 Ga0307509_10605480 Ga0307509_106054801 145
122 3300031712 Ga0265342_10067803 Ga0265342_100678032 145
123 3300035118 Ga0373954_0014987 Ga0373954_0014987_2739_3215 145
124 3300035119 Ga0373956_0165012 Ga0373956_0165012_538_1014 145
125 3300035724 Ga0373933_0086346 Ga0373933_0086346_620_1096 145
126 3300045051 Ga0451576_0527670 Ga0451576_0527670_673_1140 145
127 3300045051 Ga0451576_1963181 Ga0451576_1963181_100_567 145
128 3300046463 Ga0495653_0233516 Ga0495653_0233516_558_1034 145
129 3300046514 Ga0495618_0082273 Ga0495618_0082273_1008_1475 145
130 3300046559 Ga0495667_0623488 Ga0495667_0623488_190_657 145
131 3300046690 Ga0495624_0765613 Ga0495624_0765613_27_494 145
132 3300047317 Ga0495604_0795440 Ga0495604_0795440_72_548 145
133 3300047444 Ga0495675_0134891 Ga0495675_0134891_248_742 145
134 3300048910 Ga0496107_0448403 Ga0496107_0448403_454_921 145
135 3300048918 Ga0496115_0040977 Ga0496115_0040977_2412_2885 145
136 3300049569 Ga0501032_0028155 Ga0501032_0028155_2650_3135 145
137 3300049570 Ga0501033_0045144 Ga0501033_0045144_237_704 145
138 3300049570 Ga0501033_0082541 Ga0501033_0082541_859_1344 145
139 3300049573 Ga0501037_0209257 Ga0501037_0209257_754_1239 145
140 3300049575 Ga0501039_0273012 Ga0501039_0273012_827_1294 145
141 3300049580 Ga0501046_0070767 Ga0501046_0070767_1728_2195 145
142 3300049822 Ga0501035_0127836 Ga0501035_0127836_446_913 145
143 3300049823 Ga0501044_1555382 Ga0501044_1555382_18_485 145
144 3300053098 Ga0500650_0041990 Ga0500650_0041990_1146_1616 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

7

149

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d51-assembly1.cif.gz_B crystal structure of a truly knotted protein: cyclized yibk from haemophilus influenzae 0.873 2 145
7e3q-assembly1.cif.gz_B crystal structure of sah bound trml from vibrio vulnificus 0.8676 1 143
3n4j-assembly1.cif.gz_A putative rna methyltransferase from yersinia pestis 0.8672 2 145
7e3s-assembly1.cif.gz_B crystal structure of trml from shewanella oneidensis 0.8659 2 144
7d51-assembly1.cif.gz_B crystal structure of a truly knotted protein: cyclized yibk from haemophilus influenzae 0.8618 2 145
ID Description Score Start End Superfamily
5co4A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.855 2 139 3.40.1280.10
af_C6TCU8_69_240_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8407 2 145 3.40.1280.10
3l8uA00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8374 2 142 3.40.1280.10
af_O50394_1_154_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.831 2 144 3.40.1280.10
af_C6TCU8_69_240_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8301 2 145 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A315QNB4-F1-model_v4 tRNA (Cytidine/uridine-2'-O-)-methyltransferase 0.9502 60 144 GO:0002130
GO:0003723
GO:0008173
AF-A0A353EY87-F1-model_v4 tRNA (Uridine(34)/cytosine(34)/5-carboxymethylaminomethyluridine(34)-2'-O)-methyltransferase TrmL 0.9502 62 144 GO:0002130
GO:0003723
GO:0008173
AF-A0A7V9ZQV0-F1-model_v4 tRNA/rRNA methyltransferase SpoU type domain-containing protein 0.9402 64 143 GO:0002130
GO:0003723
GO:0008173
AF-A0A3D3RYI4-F1-model_v4 deleted 0.9381 60 144
AF-A0A2V6H5X4-F1-model_v4 tRNA (Cytidine(34)-2'-O)-methyltransferase 0.9292 61 139 GO:0002130
GO:0003723
GO:0008173

Feature Viewer

pLDDT pTM Quality
87.42 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map