F190147

General Info

Members Datasets Scaffolds Average Seq Length
143 119 132 215

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0001796|Ga0500616_0001796_15139_15873
Length 244
Sequence MPDLRRAVAASGPILSDPDGRLGSMTYTGDVSVGGPSAVRELPDATIRKASVSPQDNNAYLITCTATGEQLLIDAADDVSRLTGLIAEGGEGLVTVVTTHQHWDHHRALKEVVAATGADTAAGREDAGELPIPVDVELTQGDTVAVGELSLDVVHLRGHTPGSVALVLTSSDGSVHAFTGDSLFPGGVGNTRGDKANFASLLDDVEQRLFGVYPDETWIYPGHGKDSTLGAERPHLGEWRERGW

Samples

Sample ID Description Type Environment
1 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
2 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
3 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
4 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
5 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
6 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
7 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
8 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
9 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
10 2891562705 Microbispora tritici MT50 Isolate Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
43 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
44 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
45 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
46 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
47 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
48 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
49 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
50 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
51 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
52 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
53 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
57 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
58 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
59 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
60 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
61 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
62 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
63 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
64 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
65 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
66 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
69 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
70 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
71 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
72 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
73 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
74 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
75 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
76 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
77 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
78 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
79 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
80 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
81 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
82 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
83 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
84 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
85 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
86 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
87 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
88 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
89 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
90 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
91 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
94 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
95 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
101 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
102 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
103 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
104 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
105 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
106 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
107 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
108 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
109 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
110 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
111 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
112 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
113 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
114 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
115 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
116 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
117 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
118 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
119 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.91
Metatranscriptomes 1.4
Isolates 7.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.18
Nodule 0
Rhizoplane 4.9
Rhizosphere 63.64
Stem 0
Stem Tuber 0
Unclassified 13.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10105987 3300003320 Bacteria 7192
2 JGI25405J52794_10017386 3300003911 Bacteria 1427
3 Ga0070670_100764938 3300005331 Bacteria 871
4 Ga0070689_100236123 3300005340 Bacteria 1504
5 Ga0070687_100304597 3300005343 Bacteria 1012
6 Ga0070709_10217861 3300005434 Bacteria 1360
7 Ga0070714_100000261 3300005435 Bacteria 41105
8 Ga0070714_100530708 3300005435 Bacteria 1125
9 Ga0070713_100020386 3300005436 Bacteria 5083
10 Ga0070700_100315668 3300005441 Bacteria 1146
11 Ga0070678_100708467 3300005456 Bacteria 907
12 Ga0070706_100350205 3300005467 Bacteria 1376
13 Ga0070665_100786869 3300005548 Bacteria 964
14 Ga0068852_100266436 3300005616 Bacteria 1647
15 Ga0068861_100414626 3300005719 Bacteria 1198
16 Ga0081455_10001337 3300005937 Bacteria 30512
17 Ga0081539_10027880 3300005985 Bacteria 3565
18 Ga0075365_10002755 3300006038 Bacteria 8777
19 Ga0075365_10111193 3300006038 Bacteria 1883
20 Ga0075368_10002145 3300006042 Bacteria 6375
21 Ga0075368_10002377 3300006042 Bacteria 6127
22 Ga0075363_100018773 3300006048 Bacteria 3449
23 Ga0075364_10145220 3300006051 Bacteria 1597
24 Ga0075367_10004474 3300006178 Bacteria 6831
25 Ga0075367_10069254 3300006178 Bacteria 2118
26 Ga0075370_10163435 3300006353 Bacteria 1307
27 Ga0111539_11062818 3300009094 Bacteria 941
28 Ga0114129_10145408 3300009147 Bacteria 3248
29 Ga0224712_10004974 3300022467 Bacteria 3649
30 Ga0207650_10670378 3300025925 Bacteria 875
31 Ga0207700_10126717 3300025928 Bacteria 2078
32 Ga0207664_10001805 3300025929 Bacteria 14098
33 Ga0207664_10386792 3300025929 Bacteria 1242
34 Ga0207708_10521810 3300026075 Bacteria 998
35 Ga0207675_100025033 3300026118 Bacteria 5555
36 Ga0207683_10024287 3300026121 Bacteria 5218
37 Ga0209813_10022608 3300027866 Bacteria 1780
38 Ga0307515_10282897 3300028794 Bacteria 1364
39 Ga0307511_10218995 3300030521 Bacteria 959
40 Ga0307512_10004360 3300030522 Bacteria 15591
41 Ga0307512_10108960 3300030522 Bacteria 1835
42 Ga0265340_10000813 3300031247 Bacteria 17720
43 Ga0307513_10004391 3300031456 Bacteria 18827
44 Ga0307508_10000544 3300031616 Bacteria 44618
45 Ga0307508_10029194 3300031616 Bacteria 4987
46 Ga0307407_10200330 3300031903 Bacteria 1337
47 Ga0307409_100137202 3300031995 Bacteria 2101
48 Ga0307409_100429337 3300031995 Bacteria 1270
49 Ga0307415_100600786 3300032126 Bacteria 979
50 Ga0307507_10000019 3300033179 Bacteria 224026
51 Ga0307507_10085451 3300033179 Bacteria 2744
52 Ga0307510_10105760 3300033180 Bacteria 2581
53 Ga0395900_0705409 3300037418 Bacteria 942
54 Ga0395898_0080803 3300037466 Bacteria 3135
55 Ga0395901_0146443 3300038443 Bacteria 2482
56 Ga0451789_0853975 3300041443 Bacteria 1258
57 Ga0451791_0571665 3300041451 Bacteria 1241
58 Ga0451843_0106622 3300041509 Bacteria 1433
59 Ga0451843_0240210 3300041509 Bacteria 1157
60 Ga0466969_0037667 3300044656 Bacteria 2437
61 Ga0466966_0047432 3300044684 Bacteria 2739
62 Ga0466961_0145412 3300044693 Bacteria 1483
63 Ga0466963_0411011 3300044694 Bacteria 954
64 Ga0466971_0041735 3300044719 Bacteria 2061
65 Ga0466957_0102044 3300044842 Bacteria 1810
66 Ga0466958_0048304 3300045836 Bacteria 2571
67 Ga0466967_0094171 3300045976 Bacteria 2727
68 Ga0495592_0068535 3300046454 Bacteria 2590
69 Ga0495629_0000433 3300046459 Bacteria 34936
70 Ga0495651_0012919 3300046462 Bacteria 6452
71 Ga0495664_0188631 3300046477 Bacteria 1250
72 Ga0495594_0110957 3300046499 Bacteria 1547
73 Ga0495618_0019045 3300046514 Bacteria 4220
74 Ga0495628_0042139 3300046516 Bacteria 3642
75 Ga0495628_0198672 3300046516 Bacteria 1511
76 Ga0495628_0242741 3300046516 Bacteria 1347
77 Ga0495652_0002682 3300046529 Bacteria 18106
78 Ga0495587_0026750 3300046536 Bacteria 3514
79 Ga0495634_0000530 3300046642 Bacteria 37401
80 Ga0495634_0239268 3300046642 Bacteria 1114
81 Ga0495635_0024073 3300046663 Bacteria 4244
82 Ga0495635_0050996 3300046663 Bacteria 2852
83 Ga0495657_0135689 3300046675 Bacteria 1537
84 Ga0495657_0313095 3300046675 Bacteria 934
85 Ga0495599_0016911 3300046678 Bacteria 4532
86 Ga0495599_0370896 3300046678 Bacteria 856
87 Ga0495646_0009205 3300046680 Bacteria 6267
88 Ga0495646_0084335 3300046680 Bacteria 1845
89 Ga0495646_0203419 3300046680 Bacteria 1077
90 Ga0495613_0109882 3300046689 Bacteria 1987
91 Ga0495600_0000193 3300046809 Bacteria 35135
92 Ga0495600_0034095 3300046809 Bacteria 3305
93 Ga0495604_0000481 3300047317 Bacteria 35106
94 Ga0495674_0314101 3300047319 Bacteria 1278
95 Ga0495676_0135063 3300047321 Bacteria 1775
96 Ga0495602_0358181 3300048088 Bacteria 1051
97 Ga0495614_0046416 3300048089 Bacteria 1862
98 Ga0496101_0212290 3300048904 Bacteria 1500
99 Ga0496104_0061042 3300048907 Bacteria 3573
100 Ga0496106_0406531 3300048909 Bacteria 1094
101 Ga0496109_0315056 3300048912 Bacteria 1476
102 Ga0496114_0019654 3300048917 Bacteria 5474
103 Ga0496126_0000665 3300048929 Bacteria 63606
104 Ga0501311_034868 3300049527 Bacteria 743
105 Ga0501032_0000208 3300049569 Bacteria 48991
106 Ga0501038_0370232 3300049574 Bacteria 1113
107 Ga0501039_0093928 3300049575 Bacteria 2338
108 Ga0501043_0023007 3300049579 Bacteria 4887
109 Ga0501072_0217157 3300049588 Bacteria 1524
110 Ga0501077_0375061 3300049593 Bacteria 909
111 Ga0501081_0211382 3300049743 Bacteria 1409
112 Ga0501045_0421042 3300049824 Bacteria 994
113 nmdc:mga03n38_117950_c1 3300050490 Bacteria 1301
114 nmdc:mga03n38_6999_c1 3300050490 Bacteria 3963
115 nmdc:mga0yw44_2506_c1 3300050492 Bacteria 7864
116 nmdc:mga0yw44_63461_c1 3300050492 Bacteria 2271
117 nmdc:mga06z11_117699_c1 3300050494 Bacteria 1479
118 nmdc:mga06z11_371749_c1 3300050494 Bacteria 858
119 nmdc:mga06z11_5793_c1 3300050494 Bacteria 4983
120 nmdc:mga04h51_27011_c1 3300050495 Bacteria 1780
121 nmdc:mga07m45_330778_c1 3300050496 Bacteria 885
122 Ga0495601_0003405 3300053077 Bacteria 9117
123 Ga0495612_0006948 3300053078 Bacteria 4631
124 Ga0495619_0419928 3300053085 Bacteria 923
125 Ga0500556_0000917 3300053104 Bacteria 16230
126 Ga0500593_000244 3300053117 Bacteria 22282
127 Ga0500573_0012838 3300053140 Bacteria 4710
128 Ga0500573_0167320 3300053140 Bacteria 1191
129 Ga0500616_0001796 3300053153 Bacteria 19540
130 Ga0500630_188868 3300053159 Bacteria 819
131 Ga0500637_0334709 3300053178 Bacteria 812
132 Ga0466962_0052499 3300061719 Bacteria 1948

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049588 Ga0501072_0217157 Ga0501072_0217157_216_869 188
2 3300050494 nmdc:mga06z11_371749_c1 nmdc:mga06z11_371749_c1_176_847 190
3 3300046675 Ga0495657_0313095 Ga0495657_0313095_16_660 192
4 3300049574 Ga0501038_0370232 Ga0501038_0370232_249_923 194
5 3300049593 Ga0501077_0375061 Ga0501077_0375061_126_800 194
6 3300005436 Ga0070713_100020386 Ga0070713_1000203864 195
7 3300046516 Ga0495628_0242741 Ga0495628_0242741_202_864 198
8 3300046678 Ga0495599_0370896 Ga0495599_0370896_140_796 198
9 3300048088 Ga0495602_0358181 Ga0495602_0358181_328_990 198
10 3300050494 nmdc:mga06z11_117699_c1 nmdc:mga06z11_117699_c1_466_1140 198
11 3300005331 Ga0070670_100764938 Ga0070670_1007649381 199
12 3300025925 Ga0207650_10670378 Ga0207650_106703781 199
13 3300048904 Ga0496101_0212290 Ga0496101_0212290_694_1356 199
14 3300048909 Ga0496106_0406531 Ga0496106_0406531_293_955 199
15 iso_pu_bacteria 2728369276 2729908089 201
16 3300005467 Ga0070706_100350205 Ga0070706_1003502053 202
17 3300006353 Ga0075370_10163435 Ga0075370_101634352 202
18 3300048912 Ga0496109_0315056 Ga0496109_0315056_33_695 202
19 3300048917 Ga0496114_0019654 Ga0496114_0019654_2138_2812 202
20 3300049575 Ga0501039_0093928 Ga0501039_0093928_744_1397 202
21 3300050496 nmdc:mga07m45_330778_c1 nmdc:mga07m45_330778_c1_31_642 202
22 3300049527 Ga0501311_034868 Ga0501311_034868_113_733 203
23 3300005616 Ga0068852_100266436 Ga0068852_1002664363 205
24 3300006178 Ga0075367_10069254 Ga0075367_100692541 205
25 3300031995 Ga0307409_100429337 Ga0307409_1004293372 205
26 3300048907 Ga0496104_0061042 Ga0496104_0061042_1512_2135 205
27 3300050490 nmdc:mga03n38_6999_c1 nmdc:mga03n38_6999_c1_2778_3452 205
28 3300006042 Ga0075368_10002145 Ga0075368_100021457 206
29 3300006048 Ga0075363_100018773 Ga0075363_1000187733 206
30 3300041451 Ga0451791_0571665 Ga0451791_0571665_135_779 207
31 3300026121 Ga0207683_10024287 Ga0207683_100242872 208
32 3300049824 Ga0501045_0421042 Ga0501045_0421042_294_968 208
33 iso_pu_bacteria 2856741275 2856745840 209
34 iso_pu_bacteria 2891395885 2891400703 209
35 iso_pu_bacteria 2891554331 2891560799 209
36 iso_pu_bacteria 2891562705 2891565661 209
37 iso_pu_bacteria 8055172936 8055179797 209
38 3300049569 Ga0501032_0000208 Ga0501032_0000208_10482_11141 210
39 3300049579 Ga0501043_0023007 Ga0501043_0023007_1750_2409 210
40 iso_pu_bacteria 2515154088 2515495239 211
41 iso_pu_bacteria 2515154129 2515722263 211
42 iso_pu_bacteria 2515154137 2515754805 211
43 iso_pu_bacteria 2515154202 2516085401 212
44 iso_pu_bacteria 2515154203 2516088448 212
45 3300031616 Ga0307508_10000544 Ga0307508_1000054436 213
46 3300028794 Ga0307515_10282897 Ga0307515_102828972 214
47 3300030522 Ga0307512_10108960 Ga0307512_101089603 214
48 3300045976 Ga0466967_0094171 Ga0466967_0094171_1324_1971 214
49 3300053159 Ga0500630_188868 Ga0500630_188868_22_669 214
50 3300031456 Ga0307513_10004391 Ga0307513_1000439115 215
51 3300041443 Ga0451789_0853975 Ga0451789_0853975_163_825 215
52 3300006042 Ga0075368_10002377 Ga0075368_100023771 216
53 3300006178 Ga0075367_10004474 Ga0075367_100044743 216
54 3300027866 Ga0209813_10022608 Ga0209813_100226081 216
55 3300030522 Ga0307512_10004360 Ga0307512_100043603 216
56 3300031247 Ga0265340_10000813 Ga0265340_100008136 216
57 3300033179 Ga0307507_10085451 Ga0307507_100854512 216
58 3300033180 Ga0307510_10105760 Ga0307510_101057602 216
59 3300041509 Ga0451843_0106622 Ga0451843_0106622_73_744 216
60 3300044656 Ga0466969_0037667 Ga0466969_0037667_1773_2423 216
61 3300046459 Ga0495629_0000433 Ga0495629_0000433_28208_28861 216
62 3300046462 Ga0495651_0012919 Ga0495651_0012919_2404_3057 216
63 3300046477 Ga0495664_0188631 Ga0495664_0188631_233_886 216
64 3300046499 Ga0495594_0110957 Ga0495594_0110957_347_1000 216
65 3300046516 Ga0495628_0198672 Ga0495628_0198672_540_1193 216
66 3300046536 Ga0495587_0026750 Ga0495587_0026750_455_1108 216
67 3300046642 Ga0495634_0000530 Ga0495634_0000530_28208_28861 216
68 3300046663 Ga0495635_0024073 Ga0495635_0024073_3224_3877 216
69 3300046675 Ga0495657_0135689 Ga0495657_0135689_118_771 216
70 3300046680 Ga0495646_0009205 Ga0495646_0009205_480_1133 216
71 3300046689 Ga0495613_0109882 Ga0495613_0109882_279_932 216
72 3300046809 Ga0495600_0000193 Ga0495600_0000193_28208_28861 216
73 3300047317 Ga0495604_0000481 Ga0495604_0000481_25939_26592 216
74 3300047319 Ga0495674_0314101 Ga0495674_0314101_561_1214 216
75 3300047321 Ga0495676_0135063 Ga0495676_0135063_778_1431 216
76 3300048089 Ga0495614_0046416 Ga0495614_0046416_338_991 216
77 3300049743 Ga0501081_0211382 Ga0501081_0211382_36_707 216
78 3300050494 nmdc:mga06z11_5793_c1 nmdc:mga06z11_5793_c1_1016_1669 216
79 3300050495 nmdc:mga04h51_27011_c1 nmdc:mga04h51_27011_c1_990_1643 216
80 3300003320 rootH2_10105987 rootH2_101059874 217
81 3300003911 JGI25405J52794_10017386 JGI25405J52794_100173862 217
82 3300005340 Ga0070689_100236123 Ga0070689_1002361231 217
83 3300005343 Ga0070687_100304597 Ga0070687_1003045972 217
84 3300005434 Ga0070709_10217861 Ga0070709_102178612 217
85 3300005435 Ga0070714_100000261 Ga0070714_10000026118 217
86 3300005435 Ga0070714_100530708 Ga0070714_1005307082 217
87 3300005441 Ga0070700_100315668 Ga0070700_1003156681 217
88 3300005456 Ga0070678_100708467 Ga0070678_1007084671 217
89 3300005548 Ga0070665_100786869 Ga0070665_1007868691 217
90 3300005719 Ga0068861_100414626 Ga0068861_1004146262 217
91 3300005937 Ga0081455_10001337 Ga0081455_1000133720 217
92 3300005985 Ga0081539_10027880 Ga0081539_100278802 217
93 3300006038 Ga0075365_10002755 Ga0075365_100027553 217
94 3300006038 Ga0075365_10111193 Ga0075365_101111932 217
95 3300006051 Ga0075364_10145220 Ga0075364_101452201 217
96 3300009094 Ga0111539_11062818 Ga0111539_110628182 217
97 3300009147 Ga0114129_10145408 Ga0114129_101454082 217
98 3300022467 Ga0224712_10004974 Ga0224712_100049744 217
99 3300025928 Ga0207700_10126717 Ga0207700_101267172 217
100 3300025929 Ga0207664_10001805 Ga0207664_100018052 217
101 3300025929 Ga0207664_10386792 Ga0207664_103867922 217
102 3300026075 Ga0207708_10521810 Ga0207708_105218102 217
103 3300026118 Ga0207675_100025033 Ga0207675_1000250332 217
104 3300030521 Ga0307511_10218995 Ga0307511_102189952 217
105 3300031616 Ga0307508_10029194 Ga0307508_100291944 217
106 3300031903 Ga0307407_10200330 Ga0307407_102003302 217
107 3300031995 Ga0307409_100137202 Ga0307409_1001372022 217
108 3300032126 Ga0307415_100600786 Ga0307415_1006007861 217
109 3300033179 Ga0307507_10000019 Ga0307507_10000019172 217
110 3300037418 Ga0395900_0705409 Ga0395900_0705409_81_737 217
111 3300037466 Ga0395898_0080803 Ga0395898_0080803_2088_2744 217
112 3300038443 Ga0395901_0146443 Ga0395901_0146443_941_1597 217
113 3300041509 Ga0451843_0240210 Ga0451843_0240210_309_983 217
114 3300044684 Ga0466966_0047432 Ga0466966_0047432_121_774 217
115 3300044693 Ga0466961_0145412 Ga0466961_0145412_170_823 217
116 3300044694 Ga0466963_0411011 Ga0466963_0411011_268_921 217
117 3300044719 Ga0466971_0041735 Ga0466971_0041735_564_1217 217
118 3300044842 Ga0466957_0102044 Ga0466957_0102044_1032_1685 217
119 3300045836 Ga0466958_0048304 Ga0466958_0048304_1534_2187 217
120 3300046454 Ga0495592_0068535 Ga0495592_0068535_44_697 217
121 3300046514 Ga0495618_0019045 Ga0495618_0019045_2271_2924 217
122 3300046516 Ga0495628_0042139 Ga0495628_0042139_272_925 217
123 3300046529 Ga0495652_0002682 Ga0495652_0002682_11522_12175 217
124 3300046642 Ga0495634_0239268 Ga0495634_0239268_23_676 217
125 3300046663 Ga0495635_0050996 Ga0495635_0050996_38_691 217
126 3300046678 Ga0495599_0016911 Ga0495599_0016911_3059_3712 217
127 3300046680 Ga0495646_0084335 Ga0495646_0084335_515_1168 217
128 3300046680 Ga0495646_0203419 Ga0495646_0203419_235_888 217
129 3300046809 Ga0495600_0034095 Ga0495600_0034095_1676_2329 217
130 3300048929 Ga0496126_0000665 Ga0496126_0000665_24944_25615 217
131 3300050490 nmdc:mga03n38_117950_c1 nmdc:mga03n38_117950_c1_453_1127 217
132 3300050492 nmdc:mga0yw44_2506_c1 nmdc:mga0yw44_2506_c1_6053_6727 217
133 3300050492 nmdc:mga0yw44_63461_c1 nmdc:mga0yw44_63461_c1_1416_2093 217
134 3300053077 Ga0495601_0003405 Ga0495601_0003405_7310_7963 217
135 3300053078 Ga0495612_0006948 Ga0495612_0006948_684_1337 217
136 3300053085 Ga0495619_0419928 Ga0495619_0419928_59_718 217
137 3300053104 Ga0500556_0000917 Ga0500556_0000917_150_827 217
138 3300053117 Ga0500593_000244 Ga0500593_000244_6282_6959 217
139 3300053140 Ga0500573_0012838 Ga0500573_0012838_2974_3639 217
140 3300053140 Ga0500573_0167320 Ga0500573_0167320_141_815 217
141 3300053153 Ga0500616_0001796 Ga0500616_0001796_15139_15873 217
142 3300053178 Ga0500637_0334709 Ga0500637_0334709_77_730 217
143 3300061719 Ga0466962_0052499 Ga0466962_0052499_34_687 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

52

223

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ysb-assembly1.cif.gz_B crystal structure of ethe1 from myxococcus xanthus 0.8818 23 209
7l0b-assembly4.cif.gz_D crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme 0.8817 20 206
7ev5-assembly1.cif.gz_A crystal structure of bleg-1 b3 metallo-beta-lactamase 0.8792 23 209
5ve3-assembly2.cif.gz_A crystal structure of wild-type persulfide dioxygenase-rhodanese fusion protein from burkholderia phytofirmans 0.8728 21 206
5ve5-assembly2.cif.gz_B crystal structure of persulfide dioxygenase rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans in complex with glutathione 0.8714 21 206
ID Description Score Start End Superfamily
af_O06154_65_262_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9777 23 215 3.60.15.10
af_O06154_65_262_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9485 23 215 3.60.15.10
af_O53534_19_208_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.904 29 213 3.60.15.10
af_Q8N490_119_385_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8876 23 210 3.60.15.10
af_O53534_19_208_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8768 29 213 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A6G3XA39-F1-model_v4 MBL fold metallo-hydrolase 1 124 217 GO:0016787
AF-A0A0N1GVM5-F1-model_v4 deleted 0.9975 1 217
AF-A0A345T6K9-F1-model_v4 MBL fold metallo-hydrolase 0.9967 9 217 GO:0016787
AF-A0A327VLT8-F1-model_v4 Glyoxylase-like metal-dependent hydrolase (Beta-lactamase superfamily II) 0.9966 1 217 GO:0016787
AF-A0A0L8MI38-F1-model_v4 deleted 0.9964 1 217

Feature Viewer

pLDDT pTM Quality
95.79 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map