F189796

General Info

Members Datasets Scaffolds Average Seq Length
143 91 143 82

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0046160|Ga0495672_0046160_1416_1706
Length 96
Sequence MGMAKTITIYTTTTCAYCEMVKKWLGSKGLSYNVINMDEEAPEVRQRVIEMSGAMTVPVTVVEELAEGASEPSYRDITVGWNPAKLGAAVRDMVAA

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
22 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
58 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
59 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
60 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
61 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
64 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
65 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
66 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
77 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
78 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
79 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
82 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
83 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
84 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
85 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
86 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
87 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
88 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
89 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
90 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
91 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.39
Nodule 0
Rhizoplane 0.7
Rhizosphere 88.11
Stem 0
Stem Tuber 0
Unclassified 2.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10000244 3300003320 Bacteria 697651
2 Ga0070658_10003525 3300005327 Bacteria 12844
3 Ga0070683_100415983 3300005329 Bacteria 1282
4 Ga0070680_100245053 3300005336 Bacteria 1515
5 Ga0068868_102004473 3300005338 Unclassified 549
6 Ga0070671_100768588 3300005355 Unclassified 838
7 Ga0070713_100599635 3300005436 Bacteria 1046
8 Ga0070681_11037924 3300005458 Unclassified 740
9 Ga0068867_100081453 3300005459 Bacteria 2440
10 Ga0070679_100301821 3300005530 Bacteria 1552
11 Ga0070679_100445914 3300005530 Unclassified 1239
12 Ga0070684_100874954 3300005535 Unclassified 841
13 Ga0068853_100878741 3300005539 Bacteria 860
14 Ga0070686_101595167 3300005544 Unclassified 552
15 Ga0068855_100037222 3300005563 Bacteria 5788
16 Ga0068855_100083601 3300005563 Bacteria 3697
17 Ga0068855_100179086 3300005563 Bacteria 2397
18 Ga0068855_100216914 3300005563 Unclassified 2147
19 Ga0068855_101549114 3300005563 Unclassified 679
20 Ga0068855_101862809 3300005563 Unclassified 610
21 Ga0070664_100249474 3300005564 Unclassified 1595
22 Ga0068856_101478317 3300005614 Unclassified 693
23 Ga0068856_101798636 3300005614 Unclassified 624
24 Ga0068856_102420418 3300005614 Unclassified 532
25 Ga0068862_100014078 3300005844 Bacteria 6635
26 Ga0070717_10406067 3300006028 Bacteria 1224
27 Ga0070717_10930794 3300006028 Bacteria 791
28 Ga0075365_10999940 3300006038 Unclassified 589
29 Ga0075364_10058459 3300006051 Bacteria 2527
30 Ga0075362_10020843 3300006177 Bacteria 2743
31 Ga0075366_10000342 3300006195 Bacteria 21427
32 Ga0097621_100000003 3300006237 Bacteria 164830
33 Ga0097621_100001002 3300006237 Bacteria 19854
34 Ga0097621_101240263 3300006237 Unclassified 703
35 Ga0068871_100000013 3300006358 Bacteria 102533
36 Ga0068871_101926997 3300006358 Unclassified 562
37 Ga0075428_100074834 3300006844 Bacteria 3699
38 Ga0105240_11032551 3300009093 Bacteria 878
39 Ga0105245_10452501 3300009098 Unclassified 1293
40 Ga0105245_10512987 3300009098 Unclassified 1216
41 Ga0105245_11464210 3300009098 Bacteria 733
42 Ga0105247_10165159 3300009101 Bacteria 1468
43 Ga0105241_10000367 3300009174 Bacteria 34366
44 Ga0105241_10556227 3300009174 Unclassified 1031
45 Ga0105241_11148847 3300009174 Bacteria 733
46 Ga0105242_10133850 3300009176 Bacteria 2143
47 Ga0105242_10256925 3300009176 Bacteria 1576
48 Ga0105238_10631913 3300009551 Bacteria 1080
49 Ga0105238_10667620 3300009551 Bacteria 1050
50 Ga0105246_10310891 3300011119 Bacteria 1276
51 Ga0157373_10460323 3300013100 Bacteria 916
52 Ga0157370_10138188 3300013104 Unclassified 2270
53 Ga0157369_10089735 3300013105 Bacteria 3282
54 Ga0157369_11543443 3300013105 Bacteria 675
55 Ga0157369_12408774 3300013105 Unclassified 533
56 Ga0157374_12055915 3300013296 Unclassified 598
57 Ga0157374_12439557 3300013296 Unclassified 550
58 Ga0157372_10000194 3300013307 Bacteria 66925
59 Ga0157372_13423516 3300013307 Unclassified 504
60 Ga0163163_10059901 3300014325 Unclassified 3768
61 Ga0157377_10033136 3300014745 Unclassified 2818
62 Ga0207705_10101386 3300025909 Bacteria 2118
63 Ga0207654_10000546 3300025911 Bacteria 21515
64 Ga0207654_10269768 3300025911 Bacteria 1147
65 Ga0207654_10747956 3300025911 Unclassified 704
66 Ga0207654_10818867 3300025911 Bacteria 673
67 Ga0207660_10042451 3300025917 Bacteria 3193
68 Ga0207660_11331452 3300025917 Unclassified 583
69 Ga0207652_10101107 3300025921 Unclassified 2546
70 Ga0207652_10397982 3300025921 Unclassified 1243
71 Ga0207694_10737939 3300025924 Bacteria 831
72 Ga0207694_10975836 3300025924 Bacteria 717
73 Ga0207687_10450489 3300025927 Unclassified 1067
74 Ga0207687_11318967 3300025927 Unclassified 620
75 Ga0207700_10492674 3300025928 Bacteria 1084
76 Ga0207686_10095308 3300025934 Bacteria 1975
77 Ga0207686_11468413 3300025934 Unclassified 562
78 Ga0207661_10366306 3300025944 Bacteria 1302
79 Ga0207679_10715339 3300025945 Bacteria 909
80 Ga0207667_10031525 3300025949 Bacteria 5722
81 Ga0207667_10113402 3300025949 Bacteria 2795
82 Ga0207667_10452129 3300025949 Bacteria 1305
83 Ga0207667_11242009 3300025949 Unclassified 723
84 Ga0207658_10006571 3300025986 Bacteria 7925
85 Ga0207702_10650407 3300026078 Unclassified 1037
86 Ga0207648_10119715 3300026089 Bacteria 2314
87 Ga0207674_10353422 3300026116 Bacteria 1421
88 Ga0207683_11021203 3300026121 Unclassified 767
89 Ga0268265_10042094 3300028380 Unclassified 3386
90 Ga0265337_1006253 3300028556 Bacteria 4617
91 Ga0265326_10003292 3300028558 Bacteria 5320
92 Ga0265326_10017680 3300028558 Unclassified 2055
93 Ga0265334_10000049 3300028573 Bacteria 89091
94 Ga0265334_10004026 3300028573 Bacteria 6596
95 Ga0265322_10044272 3300028654 Bacteria 1268
96 Ga0265336_10000047 3300028666 Bacteria 123576
97 Ga0265338_10000003 3300028800 Bacteria 733923
98 Ga0265338_10000039 3300028800 Bacteria 236135
99 Ga0265338_10000052 3300028800 Bacteria 209239
100 Ga0265338_10000178 3300028800 Bacteria 118345
101 Ga0265338_10019537 3300028800 Bacteria 7181
102 Ga0265338_10022002 3300028800 Bacteria 6625
103 Ga0265338_10030969 3300028800 Bacteria 5255
104 Ga0265338_10033225 3300028800 Bacteria 5011
105 Ga0265338_10168155 3300028800 Bacteria 1685
106 Ga0265338_10208283 3300028800 Unclassified 1469
107 Ga0265338_10382617 3300028800 Unclassified 1006
108 Ga0265338_10436168 3300028800 Bacteria 929
109 Ga0265320_10050693 3300031240 Bacteria 2016
110 Ga0265325_10129684 3300031241 Bacteria 1209
111 Ga0265329_10079467 3300031242 Bacteria 1038
112 Ga0265339_10380907 3300031249 Bacteria 661
113 Ga0265327_10000017 3300031251 Bacteria 445264
114 Ga0265327_10000961 3300031251 Bacteria 41308
115 Ga0265327_10261410 3300031251 Unclassified 769
116 Ga0265316_10185325 3300031344 Bacteria 1548
117 Ga0265316_10285187 3300031344 Bacteria 1206
118 Ga0265316_10921146 3300031344 Bacteria 610
119 Ga0307513_10415275 3300031456 Unclassified 1077
120 Ga0265313_10012285 3300031595 Bacteria 5241
121 Ga0265314_10135881 3300031711 Bacteria 1527
122 Ga0307516_10000078 3300031730 Bacteria 106523
123 Ga0373959_0000004 3300034820 Bacteria 100872
124 Ga0395905_0002005 3300037471 Bacteria 23268
125 Ga0395901_0321106 3300038443 Bacteria 1602
126 Ga0451802_1462861 3300041460 Unclassified 817
127 Ga0495672_0000129 3300047320 Bacteria 112879
128 Ga0495672_0046160 3300047320 Unclassified 2600
129 Ga0495672_0249596 3300047320 Unclassified 862
130 Ga0496118_0088708 3300048921 Bacteria 2138
131 Ga0501037_0274484 3300049573 Unclassified 1176
132 Ga0501046_0095123 3300049580 Bacteria 2289
133 Ga0501070_0043619 3300049586 Bacteria 3732
134 Ga0501072_1481793 3300049588 Unclassified 524
135 Ga0501080_0169063 3300049742 Unclassified 2017
136 nmdc:mga03683_706_c2 3300050489 Bacteria 4888
137 nmdc:mga0yw44_546724_c1 3300050492 Bacteria 786
138 nmdc:mga0k408_17_c2 3300050493 Bacteria 97852
139 Ga0500644_0076746 3300053088 Bacteria 1218
140 Ga0500593_000001 3300053117 Bacteria 784404
141 Ga0500594_0002386 3300053118 Bacteria 4087
142 Ga0500628_000012 3300053129 Bacteria 106556
143 Ga0500604_0107452 3300053151 Bacteria 924

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041460 Ga0451802_1462861 Ga0451802_1462861_432_665 66
2 3300050489 nmdc:mga03683_706_c2 nmdc:mga03683_706_c2_3460_3693 66
3 3300005564 Ga0070664_100249474 Ga0070664_1002494742 81
4 3300006237 Ga0097621_100000003 Ga0097621_1000000036 81
5 3300006358 Ga0068871_100000013 Ga0068871_1000000134 81
6 3300014745 Ga0157377_10033136 Ga0157377_100331364 81
7 3300025945 Ga0207679_10715339 Ga0207679_107153392 81
8 3300005327 Ga0070658_10003525 Ga0070658_1000352512 82
9 3300005329 Ga0070683_100415983 Ga0070683_1004159832 82
10 3300005336 Ga0070680_100245053 Ga0070680_1002450532 82
11 3300005338 Ga0068868_102004473 Ga0068868_1020044731 82
12 3300005355 Ga0070671_100768588 Ga0070671_1007685881 82
13 3300005436 Ga0070713_100599635 Ga0070713_1005996352 82
14 3300005458 Ga0070681_11037924 Ga0070681_110379242 82
15 3300005459 Ga0068867_100081453 Ga0068867_1000814534 82
16 3300005530 Ga0070679_100301821 Ga0070679_1003018212 82
17 3300005530 Ga0070679_100445914 Ga0070679_1004459142 82
18 3300005535 Ga0070684_100874954 Ga0070684_1008749541 82
19 3300005539 Ga0068853_100878741 Ga0068853_1008787412 82
20 3300005544 Ga0070686_101595167 Ga0070686_1015951671 82
21 3300005563 Ga0068855_100037222 Ga0068855_1000372225 82
22 3300005563 Ga0068855_100083601 Ga0068855_1000836014 82
23 3300005563 Ga0068855_100179086 Ga0068855_1001790864 82
24 3300005563 Ga0068855_100216914 Ga0068855_1002169143 82
25 3300005563 Ga0068855_101549114 Ga0068855_1015491142 82
26 3300005614 Ga0068856_101478317 Ga0068856_1014783172 82
27 3300005614 Ga0068856_101798636 Ga0068856_1017986361 82
28 3300005614 Ga0068856_102420418 Ga0068856_1024204181 82
29 3300005844 Ga0068862_100014078 Ga0068862_1000140782 82
30 3300006028 Ga0070717_10406067 Ga0070717_104060671 82
31 3300006028 Ga0070717_10930794 Ga0070717_109307942 82
32 3300006038 Ga0075365_10999940 Ga0075365_109999401 82
33 3300006051 Ga0075364_10058459 Ga0075364_100584592 82
34 3300006195 Ga0075366_10000342 Ga0075366_100003426 82
35 3300006237 Ga0097621_100001002 Ga0097621_1000010029 82
36 3300006237 Ga0097621_101240263 Ga0097621_1012402631 82
37 3300006358 Ga0068871_101926997 Ga0068871_1019269971 82
38 3300006844 Ga0075428_100074834 Ga0075428_1000748342 82
39 3300009093 Ga0105240_11032551 Ga0105240_110325512 82
40 3300009098 Ga0105245_10452501 Ga0105245_104525013 82
41 3300009098 Ga0105245_10512987 Ga0105245_105129872 82
42 3300009098 Ga0105245_11464210 Ga0105245_114642102 82
43 3300009101 Ga0105247_10165159 Ga0105247_101651592 82
44 3300009174 Ga0105241_10000367 Ga0105241_1000036728 82
45 3300009174 Ga0105241_10556227 Ga0105241_105562272 82
46 3300009174 Ga0105241_11148847 Ga0105241_111488471 82
47 3300009176 Ga0105242_10133850 Ga0105242_101338501 82
48 3300009176 Ga0105242_10256925 Ga0105242_102569253 82
49 3300009551 Ga0105238_10631913 Ga0105238_106319133 82
50 3300009551 Ga0105238_10667620 Ga0105238_106676201 82
51 3300011119 Ga0105246_10310891 Ga0105246_103108912 82
52 3300013100 Ga0157373_10460323 Ga0157373_104603232 82
53 3300013104 Ga0157370_10138188 Ga0157370_101381882 82
54 3300013105 Ga0157369_10089735 Ga0157369_100897352 82
55 3300013105 Ga0157369_11543443 Ga0157369_115434431 82
56 3300013105 Ga0157369_12408774 Ga0157369_124087741 82
57 3300013296 Ga0157374_12055915 Ga0157374_120559151 82
58 3300013296 Ga0157374_12439557 Ga0157374_124395571 82
59 3300013307 Ga0157372_10000194 Ga0157372_1000019461 82
60 3300013307 Ga0157372_13423516 Ga0157372_134235161 82
61 3300014325 Ga0163163_10059901 Ga0163163_100599014 82
62 3300025909 Ga0207705_10101386 Ga0207705_101013862 82
63 3300025911 Ga0207654_10000546 Ga0207654_1000054616 82
64 3300025911 Ga0207654_10269768 Ga0207654_102697682 82
65 3300025911 Ga0207654_10747956 Ga0207654_107479562 82
66 3300025911 Ga0207654_10818867 Ga0207654_108188671 82
67 3300025917 Ga0207660_10042451 Ga0207660_100424512 82
68 3300025917 Ga0207660_11331452 Ga0207660_113314522 82
69 3300025921 Ga0207652_10101107 Ga0207652_101011071 82
70 3300025921 Ga0207652_10397982 Ga0207652_103979823 82
71 3300025924 Ga0207694_10737939 Ga0207694_107379391 82
72 3300025924 Ga0207694_10975836 Ga0207694_109758362 82
73 3300025927 Ga0207687_10450489 Ga0207687_104504892 82
74 3300025927 Ga0207687_11318967 Ga0207687_113189672 82
75 3300025928 Ga0207700_10492674 Ga0207700_104926742 82
76 3300025934 Ga0207686_10095308 Ga0207686_100953081 82
77 3300025934 Ga0207686_11468413 Ga0207686_114684131 82
78 3300025944 Ga0207661_10366306 Ga0207661_103663062 82
79 3300025949 Ga0207667_10031525 Ga0207667_100315252 82
80 3300025949 Ga0207667_10113402 Ga0207667_101134022 82
81 3300025949 Ga0207667_10452129 Ga0207667_104521292 82
82 3300025949 Ga0207667_11242009 Ga0207667_112420091 82
83 3300025986 Ga0207658_10006571 Ga0207658_100065717 82
84 3300026078 Ga0207702_10650407 Ga0207702_106504072 82
85 3300026089 Ga0207648_10119715 Ga0207648_101197154 82
86 3300026116 Ga0207674_10353422 Ga0207674_103534222 82
87 3300026121 Ga0207683_11021203 Ga0207683_110212032 82
88 3300028380 Ga0268265_10042094 Ga0268265_100420942 82
89 3300028556 Ga0265337_1006253 Ga0265337_10062532 82
90 3300028558 Ga0265326_10003292 Ga0265326_100032922 82
91 3300028558 Ga0265326_10017680 Ga0265326_100176802 82
92 3300028573 Ga0265334_10000049 Ga0265334_1000004988 82
93 3300028573 Ga0265334_10004026 Ga0265334_100040261 82
94 3300028654 Ga0265322_10044272 Ga0265322_100442723 82
95 3300028666 Ga0265336_10000047 Ga0265336_1000004767 82
96 3300028800 Ga0265338_10000003 Ga0265338_10000003430 82
97 3300028800 Ga0265338_10000039 Ga0265338_10000039223 82
98 3300028800 Ga0265338_10000052 Ga0265338_10000052151 82
99 3300028800 Ga0265338_10000178 Ga0265338_1000017828 82
100 3300028800 Ga0265338_10019537 Ga0265338_100195375 82
101 3300028800 Ga0265338_10022002 Ga0265338_100220023 82
102 3300028800 Ga0265338_10030969 Ga0265338_100309694 82
103 3300028800 Ga0265338_10033225 Ga0265338_100332253 82
104 3300028800 Ga0265338_10168155 Ga0265338_101681553 82
105 3300028800 Ga0265338_10208283 Ga0265338_102082832 82
106 3300028800 Ga0265338_10382617 Ga0265338_103826172 82
107 3300028800 Ga0265338_10436168 Ga0265338_104361682 82
108 3300031240 Ga0265320_10050693 Ga0265320_100506933 82
109 3300031241 Ga0265325_10129684 Ga0265325_101296842 82
110 3300031242 Ga0265329_10079467 Ga0265329_100794672 82
111 3300031249 Ga0265339_10380907 Ga0265339_103809072 82
112 3300031251 Ga0265327_10000017 Ga0265327_10000017103 82
113 3300031251 Ga0265327_10000961 Ga0265327_1000096115 82
114 3300031251 Ga0265327_10261410 Ga0265327_102614102 82
115 3300031344 Ga0265316_10185325 Ga0265316_101853251 82
116 3300031344 Ga0265316_10285187 Ga0265316_102851872 82
117 3300031344 Ga0265316_10921146 Ga0265316_109211462 82
118 3300031456 Ga0307513_10415275 Ga0307513_104152752 82
119 3300031595 Ga0265313_10012285 Ga0265313_100122855 82
120 3300031711 Ga0265314_10135881 Ga0265314_101358813 82
121 3300037471 Ga0395905_0002005 Ga0395905_0002005_1503_1751 82
122 3300038443 Ga0395901_0321106 Ga0395901_0321106_992_1240 82
123 3300047320 Ga0495672_0000129 Ga0495672_0000129_60616_60864 82
124 3300047320 Ga0495672_0249596 Ga0495672_0249596_418_666 82
125 3300049573 Ga0501037_0274484 Ga0501037_0274484_569_817 82
126 3300049580 Ga0501046_0095123 Ga0501046_0095123_1698_1946 82
127 3300049586 Ga0501070_0043619 Ga0501070_0043619_1293_1541 82
128 3300049588 Ga0501072_1481793 Ga0501072_1481793_177_425 82
129 3300049742 Ga0501080_0169063 Ga0501080_0169063_1743_1991 82
130 3300050492 nmdc:mga0yw44_546724_c1 nmdc:mga0yw44_546724_c1_79_327 82
131 3300050493 nmdc:mga0k408_17_c2 nmdc:mga0k408_17_c2_7859_8107 82
132 3300053088 Ga0500644_0076746 Ga0500644_0076746_83_331 82
133 3300053117 Ga0500593_000001 Ga0500593_000001_636893_637141 82
134 3300053118 Ga0500594_0002386 Ga0500594_0002386_1369_1617 82
135 3300053129 Ga0500628_000012 Ga0500628_000012_12561_12809 82
136 3300003320 rootH2_10000244 rootH2_10000244445 83
137 3300005563 Ga0068855_101862809 Ga0068855_1018628092 83
138 3300006177 Ga0075362_10020843 Ga0075362_100208433 83
139 3300031730 Ga0307516_10000078 Ga0307516_1000007833 83
140 3300034820 Ga0373959_0000004 Ga0373959_0000004_58909_59175 83
141 3300047320 Ga0495672_0046160 Ga0495672_0046160_1416_1706 83
142 3300048921 Ga0496118_0088708 Ga0496118_0088708_1704_1988 83
143 3300053151 Ga0500604_0107452 Ga0500604_0107452_445_735 83

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

7

65

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zij-assembly2.cif.gz_B crystal structure of the thioredoxin-like protein bc3987 0.9013 4 80
7c10-assembly1.cif.gz_A dithiol cgrx1 0.8839 4 81
3zij-assembly2.cif.gz_B crystal structure of the thioredoxin-like protein bc3987 0.8789 4 80
7c10-assembly2.cif.gz_B dithiol cgrx1 0.8733 4 81
4fiw-assembly1.cif.gz_A x-ray crystal structure of corynebacterium glutamicum nrdh-redoxin at 1.5a 0.8694 5 79
ID Description Score Start End Superfamily
af_O62456_16_101_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9286 4 57 3.40.30.10
af_Q54XE7_2_89_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9115 4 57 3.40.30.10
3zijB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9013 4 80 3.40.30.10
af_A4HYU2_3_106_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8922 4 59 3.40.30.10
3zijB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8789 4 80 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2M7TUG3-F1-model_v4 Glutaredoxin domain-containing protein 0.9925 1 81 GO:0009055
GO:0045454
AF-A0A1F7RF92-F1-model_v4 Glutaredoxin domain-containing protein 0.9902 1 81
AF-A0A7W1KGP9-F1-model_v4 Glutaredoxin family protein 0.9882 1 81
AF-A0A7S2UXQ4-F1-model_v4 Glutaredoxin domain-containing protein 0.9751 4 57
AF-A0A2R5GWU8-F1-model_v4 Glutaredoxin 0.9707 4 57

Feature Viewer

pLDDT pTM Quality
93.11 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map