F189560

General Info

Members Datasets Scaffolds Average Seq Length
143 84 286 230

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0097316|Ga0466966_0097316_738_1490
Length 250
Sequence VNGTPALTLDVITIFPEYLAPLRQSLLGKAIDRGQVAVRVHDLRQWTDDVHRTVDDAPYGGGPGMVLLPEPWGRALDAIADPAGDTQPRLVVPTPAGRPFTQALAEELAREPWLVFACGRYEGIDARVVDYAAQRMRVDEISLGDYVLAGGEVAVLVIAEAVGRLLPGVLGNVESAPDDSFGVGPAGLLEAPAYTRPASWRGMDVPPVLLSGNHAAIAQWRADRSRERTAERRPDLLRDDPTTRSTPPPG

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
42 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
43 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
44 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
45 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
46 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
47 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
48 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
49 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
50 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
51 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
52 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
53 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
54 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
55 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
56 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
57 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
58 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
59 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
60 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
61 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
62 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
63 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
64 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
65 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
66 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
67 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
68 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
77 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
78 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
79 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
80 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
81 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
82 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
84 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.9
Metatranscriptomes 1.4
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.99
Rhizosphere 89.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0097316 3300044684 Bacteria 1822
2 Ga0070658_10003761 3300005327 Bacteria 12421
3 Ga0070658_10038020 3300005327 Bacteria 3881
4 Ga0070658_10645945 3300005327 Bacteria 918
5 Ga0070683_100058392 3300005329 Bacteria 3585
6 Ga0070690_100013005 3300005330 Bacteria 4908
7 Ga0070680_100164760 3300005336 Bacteria 1864
8 Ga0070682_100347245 3300005337 Bacteria 1105
9 Ga0070692_10048780 3300005345 Bacteria 2195
10 Ga0070659_100013839 3300005366 Bacteria 6018
11 Ga0070714_100402457 3300005435 Bacteria 1294
12 Ga0070681_10279530 3300005458 Bacteria 1580
13 Ga0070698_100502772 3300005471 Bacteria 1150
14 Ga0070679_100086567 3300005530 Bacteria 3120
15 Ga0070684_100291857 3300005535 Bacteria 1495
16 Ga0070665_100387548 3300005548 Bacteria 1405
17 Ga0068855_100020818 3300005563 Bacteria 7864
18 Ga0068856_100200265 3300005614 Bacteria 2011
19 Ga0068859_100009704 3300005617 Bacteria 9719
20 Ga0081455_10018894 3300005937 Bacteria 6539
21 Ga0081540_1064648 3300005983 Bacteria 1725
22 Ga0097620_100009704 3300006931 Bacteria 9719
23 Ga0105240_10460243 3300009093 Bacteria 1422
24 Ga0105245_10298675 3300009098 Bacteria 1580
25 Ga0105242_10212832 3300009176 Bacteria 1723
26 Ga0157371_10013814 3300013102 Bacteria 6118
27 Ga0157370_10127021 3300013104 Bacteria 2380
28 Ga0157369_10003904 3300013105 Bacteria 17682
29 Ga0157369_10012639 3300013105 Bacteria 9573
30 Ga0157369_10094298 3300013105 Bacteria 3195
31 Ga0157369_10127071 3300013105 Bacteria 2702
32 Ga0157374_10797316 3300013296 Bacteria 960
33 Ga0206354_10629035 3300020081 Bacteria 3264
34 Ga0206353_11450800 3300020082 Bacteria 2248
35 Ga0207647_10087686 3300025904 Bacteria 1859
36 Ga0207705_10002132 3300025909 Bacteria 15357
37 Ga0207657_10018863 3300025919 Bacteria 6569
38 Ga0207657_10359535 3300025919 Bacteria 1148
39 Ga0207649_10522528 3300025920 Bacteria 905
40 Ga0207652_10008604 3300025921 Bacteria 8213
41 Ga0207652_10026104 3300025921 Bacteria 4862
42 Ga0207652_10188057 3300025921 Bacteria 1857
43 Ga0207690_10042001 3300025932 Bacteria 3000
44 Ga0207690_10284819 3300025932 Bacteria 1288
45 Ga0207661_10061588 3300025944 Bacteria 3032
46 Ga0207667_10159963 3300025949 Bacteria 2317
47 Ga0207678_10048519 3300026067 Bacteria 3670
48 Ga0207702_10266712 3300026078 Bacteria 1614
49 Ga0268266_10700597 3300028379 Bacteria 976
50 Ga0373927_0050539 3300035695 Bacteria 2689
51 Ga0395899_0298054 3300037312 Bacteria 1092
52 Ga0395901_0260506 3300038443 Bacteria 1805
53 Ga0436365_1639953 3300039437 Bacteria 1124
54 Ga0466969_0063636 3300044656 Bacteria 1787
55 Ga0466972_0019588 3300044658 Bacteria 3383
56 Ga0466965_0033519 3300044683 Bacteria 2510
57 Ga0466966_0068435 3300044684 Bacteria 2229
58 Ga0466966_0094230 3300044684 Bacteria 1856
59 Ga0466961_0028113 3300044693 Bacteria 3616
60 Ga0466961_0048957 3300044693 Bacteria 2702
61 Ga0466961_0054974 3300044693 Bacteria 2539
62 Ga0466961_0075042 3300044693 Bacteria 2144
63 Ga0466961_0075964 3300044693 Bacteria 2129
64 Ga0466961_0255553 3300044693 Bacteria 1075
65 Ga0466963_0001362 3300044694 Bacteria 13067
66 Ga0466963_0014526 3300044694 Bacteria 4857
67 Ga0466963_0028931 3300044694 Bacteria 3562
68 Ga0466963_0070759 3300044694 Bacteria 2347
69 Ga0466963_0286315 3300044694 Bacteria 1158
70 Ga0466963_0307931 3300044694 Bacteria 1114
71 Ga0466964_0005201 3300044706 Bacteria 4823
72 Ga0466964_0023347 3300044706 Bacteria 2405
73 Ga0466971_0011648 3300044719 Bacteria 3851
74 Ga0466971_0014156 3300044719 Bacteria 3507
75 Ga0466971_0043667 3300044719 Bacteria 2013
76 Ga0466968_0009301 3300044735 Bacteria 3780
77 Ga0466970_0105017 3300044765 Bacteria 1540
78 Ga0466957_0007234 3300044842 Bacteria 6274
79 Ga0466957_0074035 3300044842 Bacteria 2112
80 Ga0466957_0091115 3300044842 Bacteria 1910
81 Ga0466959_0038875 3300045049 Bacteria 3516
82 Ga0466959_0060332 3300045049 Bacteria 2760
83 Ga0466959_0244156 3300045049 Bacteria 1239
84 Ga0466958_0001921 3300045836 Bacteria 10169
85 Ga0466958_0005708 3300045836 Bacteria 6721
86 Ga0466958_0012760 3300045836 Bacteria 4765
87 Ga0466958_0077764 3300045836 Bacteria 2038
88 Ga0466967_0018985 3300045976 Bacteria 5516
89 Ga0466967_0019226 3300045976 Bacteria 5487
90 Ga0466967_0034344 3300045976 Bacteria 4303
91 Ga0466967_0040212 3300045976 Bacteria 4025
92 Ga0466967_0044355 3300045976 Bacteria 3857
93 Ga0466967_0056868 3300045976 Bacteria 3451
94 Ga0466967_0069729 3300045976 Bacteria 3143
95 Ga0466967_0128853 3300045976 Bacteria 2347
96 Ga0466967_0129338 3300045976 Bacteria 2342
97 Ga0466967_0481629 3300045976 Bacteria 1216
98 Ga0466967_0581970 3300045976 Bacteria 1104
99 Ga0466967_0601601 3300045976 Bacteria 1085
100 Ga0496100_0144370 3300048903 Bacteria 1691
101 Ga0496102_0000639 3300048905 Bacteria 35597
102 Ga0496102_0001496 3300048905 Bacteria 20647
103 Ga0496102_0393279 3300048905 Bacteria 1304
104 Ga0496103_0001461 3300048906 Bacteria 15822
105 Ga0496103_0082833 3300048906 Bacteria 2019
106 Ga0496108_0037841 3300048911 Bacteria 4019
107 Ga0496109_0014020 3300048912 Bacteria 6967
108 Ga0496111_0137477 3300048914 Bacteria 1810
109 Ga0496112_0188348 3300048915 Bacteria 2026
110 Ga0496119_0013360 3300048922 Bacteria 6554
111 Ga0496121_0224598 3300048924 Bacteria 1320
112 Ga0496126_0054898 3300048929 Bacteria 3606
113 Ga0496126_0353722 3300048929 Bacteria 1201
114 Ga0501031_0018098 3300049568 Bacteria 4583
115 Ga0501032_0039427 3300049569 Bacteria 3213
116 Ga0501032_0064535 3300049569 Bacteria 2451
117 Ga0501034_0096632 3300049571 Bacteria 2950
118 Ga0501037_0014745 3300049573 Bacteria 5749
119 Ga0501037_0148847 3300049573 Bacteria 1674
120 Ga0501038_0001641 3300049574 Bacteria 20815
121 Ga0501038_0474083 3300049574 Bacteria 960
122 Ga0501046_0109650 3300049580 Bacteria 2110
123 Ga0501047_0006256 3300049581 Bacteria 11189
124 Ga0501047_0261627 3300049581 Bacteria 1578
125 Ga0501047_0319797 3300049581 Bacteria 1392
126 Ga0501048_0000032 3300049582 Bacteria 65543
127 Ga0501069_0000820 3300049585 Bacteria 14664
128 Ga0501070_0006910 3300049586 Bacteria 9657
129 Ga0501070_0009969 3300049586 Bacteria 8034
130 Ga0501070_0015471 3300049586 Bacteria 6417
131 Ga0501070_0113605 3300049586 Bacteria 2238
132 Ga0501073_0022962 3300049589 Bacteria 4486
133 Ga0501073_0315490 3300049589 Bacteria 1079
134 Ga0501074_0035385 3300049590 Bacteria 3619
135 Ga0501079_0013008 3300049741 Bacteria 6348
136 Ga0501080_0001623 3300049742 Bacteria 19125
137 Ga0501080_0011786 3300049742 Bacteria 8011
138 Ga0501080_0027510 3300049742 Bacteria 5288
139 Ga0501080_0031251 3300049742 Bacteria 4962
140 Ga0501035_0006273 3300049822 Bacteria 11181
141 Ga0501044_0048354 3300049823 Bacteria 4394
142 Ga0501044_0318506 3300049823 Bacteria 1480
143 2515855837 2515154155 Bacteria 7985436
144 Ga0466966_0097316
145 Ga0070658_10003761
146 Ga0070658_10038020
147 Ga0070658_10645945
148 Ga0070683_100058392
149 Ga0070690_100013005
150 Ga0070680_100164760
151 Ga0070682_100347245
152 Ga0070692_10048780
153 Ga0070659_100013839
154 Ga0070714_100402457
155 Ga0070681_10279530
156 Ga0070698_100502772
157 Ga0070679_100086567
158 Ga0070684_100291857
159 Ga0070665_100387548
160 Ga0068855_100020818
161 Ga0068856_100200265
162 Ga0068859_100009704
163 Ga0081455_10018894
164 Ga0081540_1064648
165 Ga0097620_100009704
166 Ga0105240_10460243
167 Ga0105245_10298675
168 Ga0105242_10212832
169 Ga0157371_10013814
170 Ga0157370_10127021
171 Ga0157369_10003904
172 Ga0157369_10012639
173 Ga0157369_10094298
174 Ga0157369_10127071
175 Ga0157374_10797316
176 Ga0206354_10629035
177 Ga0206353_11450800
178 Ga0207647_10087686
179 Ga0207705_10002132
180 Ga0207657_10018863
181 Ga0207657_10359535
182 Ga0207649_10522528
183 Ga0207652_10008604
184 Ga0207652_10026104
185 Ga0207652_10188057
186 Ga0207690_10042001
187 Ga0207690_10284819
188 Ga0207661_10061588
189 Ga0207667_10159963
190 Ga0207678_10048519
191 Ga0207702_10266712
192 Ga0268266_10700597
193 Ga0373927_0050539
194 Ga0395899_0298054
195 Ga0395901_0260506
196 Ga0436365_1639953
197 Ga0466969_0063636
198 Ga0466972_0019588
199 Ga0466965_0033519
200 Ga0466966_0068435
201 Ga0466966_0094230
202 Ga0466961_0028113
203 Ga0466961_0048957
204 Ga0466961_0054974
205 Ga0466961_0075042
206 Ga0466961_0075964
207 Ga0466961_0255553
208 Ga0466963_0001362
209 Ga0466963_0014526
210 Ga0466963_0028931
211 Ga0466963_0070759
212 Ga0466963_0286315
213 Ga0466963_0307931
214 Ga0466964_0005201
215 Ga0466964_0023347
216 Ga0466971_0011648
217 Ga0466971_0014156
218 Ga0466971_0043667
219 Ga0466968_0009301
220 Ga0466970_0105017
221 Ga0466957_0007234
222 Ga0466957_0074035
223 Ga0466957_0091115
224 Ga0466959_0038875
225 Ga0466959_0060332
226 Ga0466959_0244156
227 Ga0466958_0001921
228 Ga0466958_0005708
229 Ga0466958_0012760
230 Ga0466958_0077764
231 Ga0466967_0018985
232 Ga0466967_0019226
233 Ga0466967_0034344
234 Ga0466967_0040212
235 Ga0466967_0044355
236 Ga0466967_0056868
237 Ga0466967_0069729
238 Ga0466967_0128853
239 Ga0466967_0129338
240 Ga0466967_0481629
241 Ga0466967_0581970
242 Ga0466967_0601601
243 Ga0496100_0144370
244 Ga0496102_0000639
245 Ga0496102_0001496
246 Ga0496102_0393279
247 Ga0496103_0001461
248 Ga0496103_0082833
249 Ga0496108_0037841
250 Ga0496109_0014020
251 Ga0496111_0137477
252 Ga0496112_0188348
253 Ga0496119_0013360
254 Ga0496121_0224598
255 Ga0496126_0054898
256 Ga0496126_0353722
257 Ga0501031_0018098
258 Ga0501032_0039427
259 Ga0501032_0064535
260 Ga0501034_0096632
261 Ga0501037_0014745
262 Ga0501037_0148847
263 Ga0501038_0001641
264 Ga0501038_0474083
265 Ga0501046_0109650
266 Ga0501047_0006256
267 Ga0501047_0261627
268 Ga0501047_0319797
269 Ga0501048_0000032
270 Ga0501069_0000820
271 Ga0501070_0006910
272 Ga0501070_0009969
273 Ga0501070_0015471
274 Ga0501070_0113605
275 Ga0501073_0022962
276 Ga0501073_0315490
277 Ga0501074_0035385
278 Ga0501079_0013008
279 Ga0501080_0001623
280 Ga0501080_0011786
281 Ga0501080_0027510
282 Ga0501080_0031251
283 Ga0501035_0006273
284 Ga0501044_0048354
285 Ga0501044_0318506
286 2515855837

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01746

tRNA_m1G_MT

tRNA (Guanine-1)-methyltransferase

27

234

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zhj-assembly1.cif.gz_A-2 crystal structure of trmd from mycobacterium tuberculosis in complex with s-adenosyl homocysteine (sah) 0.727 1 226
6jof-assembly1.cif.gz_A-2 crystal structure of trmd from mycobacterium tuberculosis in complex with active-site inhibitor 0.7237 1 226
5zhj-assembly1.cif.gz_A-2 crystal structure of trmd from mycobacterium tuberculosis in complex with s-adenosyl homocysteine (sah) 0.7204 1 226
6jof-assembly1.cif.gz_A-2 crystal structure of trmd from mycobacterium tuberculosis in complex with active-site inhibitor 0.7171 1 226
6qox-assembly1.cif.gz_B crystal structure of trmd, a trna-(n1g37) methyltransferase, from mycobacterium abscessus in complex with fragment 27 (methyl 2-(hydroxymethyl)-6h-thieno[2,3-b]pyrrole-5-carboxylate) 0.7117 1 229
ID Description Score Start End Superfamily
5zhiB01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8767 1 166 3.40.1280.10
5zhiB01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8665 1 166 3.40.1280.10
5wyrA01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8528 1 166 3.40.1280.10
5wyrA01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8383 1 166 3.40.1280.10
3iefB01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8327 1 162 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A2S9GJY2-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD 0.9148 66 149 GO:0002939
GO:0005829
GO:0052906
AF-A0A6J4M2Z6-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) 0.901 1 167 GO:0002939
GO:0005829
GO:0052906
AF-A0A6G3VUS0-F1-model_v4 deleted 0.8926 1 166
AF-A0A810MMS7-F1-model_v4 deleted 0.8867 1 139
AF-A0A6I3E590-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD 0.8808 1 138 GO:0002939
GO:0005829
GO:0052906

Map