F189420

General Info

Members Datasets Scaffolds Average Seq Length
143 95 286 118

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1099620|Ga0436364_1099620_379_759
Length 126
Sequence MIQRSIVETFLPLKPHWFHVLLSLADEEQHGYGIMQEVFERTGGKVRLWPATLYGTIKRLMEEGLTEEAGARADKARGKPDDDSRRRYYRLTPLGRRVLAAECRRLEELVRIIHAKRGLAERKSES

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
34 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
42 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
43 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
44 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
45 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
46 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
47 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
48 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
49 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
50 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
51 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
52 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
53 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
54 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
55 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
56 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
57 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
58 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
59 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
60 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
61 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
62 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
63 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
64 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
65 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
66 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
67 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
68 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
69 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
70 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
71 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
72 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
73 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
74 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
75 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
76 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
77 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
78 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
79 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
80 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
81 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
82 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
83 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
84 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
85 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
86 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
87 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
88 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
89 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
90 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
91 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
92 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
93 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
94 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
95 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.7
Rhizosphere 97.2
Stem 0
Stem Tuber 0
Unclassified 36.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_1099620 3300037853 Bacteria 788
2 Ga0070676_10715776 3300005328 Unclassified 732
3 Ga0070683_100000011 3300005329 Bacteria 283682
4 Ga0070683_100028218 3300005329 Bacteria 5071
5 Ga0070670_100086483 3300005331 Bacteria 2693
6 Ga0070670_100719962 3300005331 Unclassified 898
7 Ga0070680_100750987 3300005336 Unclassified 840
8 Ga0070667_101077610 3300005367 Unclassified 751
9 Ga0070709_10154256 3300005434 Bacteria 1590
10 Ga0070713_100995509 3300005436 Bacteria 809
11 Ga0070713_101417351 3300005436 Bacteria 674
12 Ga0070705_101339642 3300005440 Unclassified 595
13 Ga0070708_100201303 3300005445 Bacteria 1864
14 Ga0070706_102105301 3300005467 Unclassified 510
15 Ga0070698_101384582 3300005471 Bacteria 654
16 Ga0070684_100000001 3300005535 Bacteria 300240
17 Ga0070684_100071238 3300005535 Bacteria 3060
18 Ga0070684_101173527 3300005535 Unclassified 722
19 Ga0070695_100418130 3300005545 Bacteria 1020
20 Ga0070695_100562758 3300005545 Unclassified 890
21 Ga0070695_100668613 3300005545 Unclassified 822
22 Ga0070696_100003058 3300005546 Bacteria 11114
23 Ga0068864_102099326 3300005618 Bacteria 571
24 Ga0068861_100281232 3300005719 Bacteria 1433
25 Ga0070717_10367412 3300006028 Bacteria 1289
26 Ga0070717_10558561 3300006028 Bacteria 1037
27 Ga0070717_10778840 3300006028 Unclassified 870
28 Ga0070712_101422707 3300006175 Bacteria 605
29 Ga0075433_11904668 3300006852 Unclassified 510
30 Ga0075434_100086751 3300006871 Bacteria 3130
31 Ga0075435_100844908 3300007076 Bacteria 798
32 Ga0105245_11813837 3300009098 Bacteria 663
33 Ga0105248_11583353 3300009177 Unclassified 742
34 Ga0099796_10033963 3300010159 Bacteria 1682
35 Ga0105239_10958792 3300010375 Archaea 983
36 Ga0157370_10787753 3300013104 Bacteria 865
37 Ga0157370_11121523 3300013104 Unclassified 711
38 Ga0157370_11717224 3300013104 Bacteria 563
39 Ga0157369_10048740 3300013105 Bacteria 4596
40 Ga0157369_10346096 3300013105 Unclassified 1544
41 Ga0163162_12269398 3300013306 Unclassified 623
42 Ga0157372_10032616 3300013307 Bacteria 5712
43 Ga0163163_10125537 3300014325 Bacteria 2604
44 Ga0157376_10252463 3300014969 Bacteria 1648
45 Ga0228598_1001670 3300024227 Bacteria 4854
46 Ga0228598_1083045 3300024227 Unclassified 643
47 Ga0207699_10214431 3300025906 Bacteria 1311
48 Ga0207660_10287611 3300025917 Bacteria 1306
49 Ga0207700_10444011 3300025928 Bacteria 1142
50 Ga0207700_11558471 3300025928 Bacteria 585
51 Ga0207664_10628810 3300025929 Unclassified 964
52 Ga0207711_10846798 3300025941 Unclassified 851
53 Ga0207711_11039281 3300025941 Unclassified 759
54 Ga0207661_10000016 3300025944 Bacteria 305159
55 Ga0207702_11417739 3300026078 Unclassified 688
56 Ga0265323_10000415 3300028653 Bacteria 24461
57 Ga0307508_10624463 3300031616 Bacteria 681
58 Ga0373926_0093452 3300035083 Bacteria 1120
59 Ga0373934_0011933 3300035086 Bacteria 3275
60 Ga0373934_0375952 3300035086 Unclassified 592
61 Ga0373954_0049384 3300035118 Bacteria 1973
62 Ga0373954_0107347 3300035118 Unclassified 1349
63 Ga0373954_0394393 3300035118 Unclassified 684
64 Ga0373954_0470413 3300035118 Bacteria 622
65 Ga0373955_0010406 3300035172 Bacteria 4392
66 Ga0373955_0120341 3300035172 Bacteria 1526
67 Ga0373935_1529068 3300035692 Unclassified 500
68 Ga0373927_0000578 3300035695 Bacteria 27887
69 Ga0373933_0086696 3300035724 Bacteria 1927
70 Ga0373933_0369933 3300035724 Unclassified 933
71 Ga0373947_0715414 3300035725 Unclassified 683
72 Ga0373947_0744996 3300035725 Bacteria 669
73 Ga0373937_0052686 3300036401 Bacteria 3732
74 Ga0373937_0567807 3300036401 Unclassified 1078
75 Ga0373937_1040548 3300036401 Unclassified 767
76 Ga0373937_1363172 3300036401 Unclassified 657
77 Ga0373937_1483623 3300036401 Unclassified 626
78 Ga0373925_1176214 3300037068 Unclassified 630
79 Ga0395900_1141010 3300037418 Unclassified 696
80 Ga0436365_0880944 3300039437 Bacteria 5670
81 Ga0436361_1104231 3300039447 Unclassified 2635
82 Ga0453683_1046914 3300044673 Unclassified 543
83 Ga0451576_0507676 3300045051 Unclassified 1267
84 Ga0451576_0778277 3300045051 Bacteria 1005
85 Ga0451576_2161368 3300045051 Unclassified 572
86 Ga0466967_1285232 3300045976 Bacteria 729
87 Ga0495592_0011085 3300046454 Bacteria 6804
88 Ga0495592_0367483 3300046454 Unclassified 918
89 Ga0495629_0073583 3300046459 Bacteria 2386
90 Ga0495651_0154020 3300046462 Bacteria 1653
91 Ga0495653_0034017 3300046463 Bacteria 4034
92 Ga0495653_0100256 3300046463 Bacteria 2100
93 Ga0495653_0849023 3300046463 Unclassified 546
94 Ga0495580_0024732 3300046472 Unclassified 4392
95 Ga0495580_0354460 3300046472 Bacteria 993
96 Ga0495580_0504059 3300046472 Bacteria 808
97 Ga0495580_0889055 3300046472 Bacteria 573
98 Ga0495639_0300177 3300046475 Bacteria 801
99 Ga0495662_0020061 3300046476 Bacteria 3235
100 Ga0495664_0238692 3300046477 Unclassified 1099
101 Ga0495608_0137544 3300046511 Unclassified 1560
102 Ga0495608_0502098 3300046511 Bacteria 734
103 Ga0495628_0039716 3300046516 Bacteria 3762
104 Ga0495630_0065046 3300046517 Bacteria 2740
105 Ga0495652_0014381 3300046529 Bacteria 7105
106 Ga0495652_0035825 3300046529 Bacteria 4317
107 Ga0495665_0203363 3300046531 Unclassified 1026
108 Ga0495667_0006666 3300046559 Bacteria 7838
109 Ga0495667_0082993 3300046559 Bacteria 2081
110 Ga0495667_0364104 3300046559 Bacteria 913
111 Ga0495634_0076534 3300046642 Bacteria 2196
112 Ga0495635_0016216 3300046663 Bacteria 5200
113 Ga0495635_0247015 3300046663 Unclassified 1203
114 Ga0495635_0384361 3300046663 Bacteria 934
115 Ga0495659_0132194 3300046664 Bacteria 990
116 Ga0495657_0007847 3300046675 Bacteria 8193
117 Ga0495657_0855482 3300046675 Unclassified 518
118 Ga0495599_0002886 3300046678 Bacteria 10000
119 Ga0495599_0031582 3300046678 Bacteria 3324
120 Ga0495623_0012642 3300046679 Bacteria 5464
121 Ga0495623_0289722 3300046679 Unclassified 908
122 Ga0495669_0120675 3300046684 Bacteria 1228
123 Ga0495600_0002474 3300046809 Bacteria 10604
124 Ga0495600_0016111 3300046809 Bacteria 4738
125 Ga0495581_0297788 3300047315 Unclassified 943
126 Ga0495604_0060178 3300047317 Bacteria 2909
127 Ga0495604_0419398 3300047317 Unclassified 879
128 Ga0495674_0083302 3300047319 Bacteria 2742
129 Ga0495674_0201560 3300047319 Bacteria 1650
130 Ga0495680_0021360 3300047322 Bacteria 5421
131 Ga0495675_0094914 3300047444 Bacteria 1870
132 Ga0495684_0091904 3300047471 Bacteria 2298
133 Ga0495593_0403283 3300047673 Bacteria 684
134 Ga0495602_0131050 3300048088 Bacteria 2000
135 Ga0495602_0395070 3300048088 Unclassified 987
136 Ga0495602_0593443 3300048088 Unclassified 763
137 Ga0496112_0383740 3300048915 Bacteria 1346
138 nmdc:mga09592_915651_c1 3300050508 Bacteria 736
139 nmdc:mga0a205_1352799_c1 3300050515 Unclassified 560
140 Ga0495595_0683892 3300053084 Unclassified 526
141 Ga0495619_0577137 3300053085 Unclassified 770
142 Ga0501082_0006199 3300060353 Bacteria 10378
143 Ga0466962_0227117 3300061719 Bacteria 915
144 Ga0436364_1099620
145 Ga0070676_10715776
146 Ga0070683_100000011
147 Ga0070683_100028218
148 Ga0070670_100086483
149 Ga0070670_100719962
150 Ga0070680_100750987
151 Ga0070667_101077610
152 Ga0070709_10154256
153 Ga0070713_100995509
154 Ga0070713_101417351
155 Ga0070705_101339642
156 Ga0070708_100201303
157 Ga0070706_102105301
158 Ga0070698_101384582
159 Ga0070684_100000001
160 Ga0070684_100071238
161 Ga0070684_101173527
162 Ga0070695_100418130
163 Ga0070695_100562758
164 Ga0070695_100668613
165 Ga0070696_100003058
166 Ga0068864_102099326
167 Ga0068861_100281232
168 Ga0070717_10367412
169 Ga0070717_10558561
170 Ga0070717_10778840
171 Ga0070712_101422707
172 Ga0075433_11904668
173 Ga0075434_100086751
174 Ga0075435_100844908
175 Ga0105245_11813837
176 Ga0105248_11583353
177 Ga0099796_10033963
178 Ga0105239_10958792
179 Ga0157370_10787753
180 Ga0157370_11121523
181 Ga0157370_11717224
182 Ga0157369_10048740
183 Ga0157369_10346096
184 Ga0163162_12269398
185 Ga0157372_10032616
186 Ga0163163_10125537
187 Ga0157376_10252463
188 Ga0228598_1001670
189 Ga0228598_1083045
190 Ga0207699_10214431
191 Ga0207660_10287611
192 Ga0207700_10444011
193 Ga0207700_11558471
194 Ga0207664_10628810
195 Ga0207711_10846798
196 Ga0207711_11039281
197 Ga0207661_10000016
198 Ga0207702_11417739
199 Ga0265323_10000415
200 Ga0307508_10624463
201 Ga0373926_0093452
202 Ga0373934_0011933
203 Ga0373934_0375952
204 Ga0373954_0049384
205 Ga0373954_0107347
206 Ga0373954_0394393
207 Ga0373954_0470413
208 Ga0373955_0010406
209 Ga0373955_0120341
210 Ga0373935_1529068
211 Ga0373927_0000578
212 Ga0373933_0086696
213 Ga0373933_0369933
214 Ga0373947_0715414
215 Ga0373947_0744996
216 Ga0373937_0052686
217 Ga0373937_0567807
218 Ga0373937_1040548
219 Ga0373937_1363172
220 Ga0373937_1483623
221 Ga0373925_1176214
222 Ga0395900_1141010
223 Ga0436365_0880944
224 Ga0436361_1104231
225 Ga0453683_1046914
226 Ga0451576_0507676
227 Ga0451576_0778277
228 Ga0451576_2161368
229 Ga0466967_1285232
230 Ga0495592_0011085
231 Ga0495592_0367483
232 Ga0495629_0073583
233 Ga0495651_0154020
234 Ga0495653_0034017
235 Ga0495653_0100256
236 Ga0495653_0849023
237 Ga0495580_0024732
238 Ga0495580_0354460
239 Ga0495580_0504059
240 Ga0495580_0889055
241 Ga0495639_0300177
242 Ga0495662_0020061
243 Ga0495664_0238692
244 Ga0495608_0137544
245 Ga0495608_0502098
246 Ga0495628_0039716
247 Ga0495630_0065046
248 Ga0495652_0014381
249 Ga0495652_0035825
250 Ga0495665_0203363
251 Ga0495667_0006666
252 Ga0495667_0082993
253 Ga0495667_0364104
254 Ga0495634_0076534
255 Ga0495635_0016216
256 Ga0495635_0247015
257 Ga0495635_0384361
258 Ga0495659_0132194
259 Ga0495657_0007847
260 Ga0495657_0855482
261 Ga0495599_0002886
262 Ga0495599_0031582
263 Ga0495623_0012642
264 Ga0495623_0289722
265 Ga0495669_0120675
266 Ga0495600_0002474
267 Ga0495600_0016111
268 Ga0495581_0297788
269 Ga0495604_0060178
270 Ga0495604_0419398
271 Ga0495674_0083302
272 Ga0495674_0201560
273 Ga0495680_0021360
274 Ga0495675_0094914
275 Ga0495684_0091904
276 Ga0495593_0403283
277 Ga0495602_0131050
278 Ga0495602_0395070
279 Ga0495602_0593443
280 Ga0496112_0383740
281 nmdc:mga09592_915651_c1
282 nmdc:mga0a205_1352799_c1
283 Ga0495595_0683892
284 Ga0495619_0577137
285 Ga0501082_0006199
286 Ga0466962_0227117

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

20

101

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dym-assembly1.cif.gz_A-2 crystal structure of a padr family transcription regulator from hypervirulent clostridium difficile r20291 - cdpadr_0991 to 1.89 angstrom resolution 0.8745 11 108
5y8t-assembly2.cif.gz_B crystal structure of bacillus subtilis padr in complex with p-coumaric acid 0.8676 15 93
7cbv-assembly1.cif.gz_A-3 crystal structure of the transcriptional regulator padr from bacillus subtilis (space group h32) 0.8669 15 94
5x11-assembly3.cif.gz_D crystal structure of bacillus subtilis padr in complex with operator dna 0.8493 11 94
5x11-assembly4.cif.gz_H crystal structure of bacillus subtilis padr in complex with operator dna 0.8437 11 94
ID Description Score Start End Superfamily
5dymA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8744 11 108 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8452 13 97 1.10.10.10
af_Q9VP79_118_196_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8436 10 67 1.10.10.10
5y8tC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8421 11 94 1.10.10.10
5dymA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8409 11 108 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2U3L1Q7-F1-model_v4 Transcriptional regulator, PadR-like family 0.9763 4 112
AF-A0A7T9JFX3-F1-model_v4 deleted 0.9499 10 109
AF-A0A536T626-F1-model_v4 PadR family transcriptional regulator 0.9492 4 114
AF-A0A2P2BUA3-F1-model_v4 Transcriptional regulator PadR-like family 0.9474 10 111 GO:0016020
AF-A0A6I2L0P4-F1-model_v4 PadR family transcriptional regulator 0.9442 4 111

Map