F189234

General Info

Members Datasets Scaffolds Average Seq Length
143 116 286 148

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10079310|Ga0307413_100793102
Length 174
Sequence VDPMIARGSLTEARRRGTITEPATRTMTMPLLHDPAVRNSIEERLNAIRPDSPRQWGSMSVDQMLWHVNQFLAASLGEGTLAAQKSPMPPAIMKFLLMYMPWPRSAPTNKSAVPHGQHNFEAEQARCRELIAKFVSRPIDGEWPADPSFGPVSGKFASKLQAKHLDHHLRQFKA

Samples

Sample ID Description Type Environment
1 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
82 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
87 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
88 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
89 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
92 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
93 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
94 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
95 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
96 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
97 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
106 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
107 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
108 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
109 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
113 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
116 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.7
Rhizosphere 99.3
Stem 0
Stem Tuber 0
Unclassified 38.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307413_10079310 3300031824 Bacteria 2098
2 Ga0065704_10027418 3300005289 Unclassified 1625
3 Ga0065704_10343507 3300005289 Bacteria 772
4 Ga0065712_10006275 3300005290 Bacteria 2919
5 Ga0065715_10697769 3300005293 Unclassified 629
6 Ga0065707_10319053 3300005295 Unclassified 970
7 Ga0070658_10622625 3300005327 Unclassified 936
8 Ga0070683_100027905 3300005329 Bacteria 5096
9 Ga0070677_10328097 3300005333 Unclassified 786
10 Ga0070680_100232831 3300005336 Bacteria 1556
11 Ga0070689_100871547 3300005340 Unclassified 795
12 Ga0070668_100061016 3300005347 Bacteria 2921
13 Ga0070675_100350908 3300005354 Unclassified 1308
14 Ga0070675_101156525 3300005354 Unclassified 712
15 Ga0070674_100746265 3300005356 Unclassified 841
16 Ga0070667_100027745 3300005367 Bacteria 4711
17 Ga0070667_100362893 3300005367 Bacteria 1313
18 Ga0070701_10266505 3300005438 Unclassified 1040
19 Ga0070700_100386514 3300005441 Unclassified 1048
20 Ga0070678_100569933 3300005456 Unclassified 1007
21 Ga0070662_100716589 3300005457 Unclassified 847
22 Ga0068867_100471653 3300005459 Bacteria 1073
23 Ga0068867_100819664 3300005459 Unclassified 831
24 Ga0070706_100095039 3300005467 Bacteria 2766
25 Ga0070698_100018518 3300005471 Bacteria 7332
26 Ga0070698_100561048 3300005471 Unclassified 1081
27 Ga0070698_100710697 3300005471 Bacteria 947
28 Ga0070699_100151091 3300005518 Bacteria 2054
29 Ga0070684_100004858 3300005535 Bacteria 10271
30 Ga0070697_100089322 3300005536 Bacteria 2546
31 Ga0070672_101230851 3300005543 Unclassified 667
32 Ga0070686_100261670 3300005544 Unclassified 1268
33 Ga0070696_100002322 3300005546 Bacteria 12552
34 Ga0070696_100079495 3300005546 Bacteria 2320
35 Ga0070696_100245011 3300005546 Bacteria 1353
36 Ga0070665_101062687 3300005548 Bacteria 821
37 Ga0068857_100085987 3300005577 Bacteria 2811
38 Ga0068856_100006161 3300005614 Bacteria 11767
39 Ga0068859_100048787 3300005617 Bacteria 4253
40 Ga0068859_101181619 3300005617 Unclassified 842
41 Ga0068870_10195280 3300005840 Unclassified 1224
42 Ga0068870_10670475 3300005840 Unclassified 712
43 Ga0068860_100497878 3300005843 Bacteria 1216
44 Ga0068862_100186931 3300005844 Unclassified 1862
45 Ga0097621_100940651 3300006237 Unclassified 806
46 Ga0075431_100032926 3300006847 Bacteria 5342
47 Ga0075433_10805325 3300006852 Bacteria 821
48 Ga0075429_100161156 3300006880 Bacteria 1964
49 Ga0097620_100048787 3300006931 Bacteria 4253
50 Ga0097620_101181549 3300006931 Unclassified 842
51 Ga0075435_100129306 3300007076 Unclassified 2113
52 Ga0075435_100616784 3300007076 Unclassified 941
53 Ga0111539_10221265 3300009094 Bacteria 2205
54 Ga0111539_11247762 3300009094 Bacteria 863
55 Ga0105247_11109816 3300009101 Unclassified 624
56 Ga0105243_10607892 3300009148 Bacteria 1053
57 Ga0105248_10827318 3300009177 Unclassified 1045
58 Ga0105238_11717830 3300009551 Unclassified 659
59 Ga0105249_10065572 3300009553 Bacteria 3341
60 Ga0105249_11575380 3300009553 Unclassified 729
61 Ga0105239_11944983 3300010375 Unclassified 682
62 Ga0105246_10335899 3300011119 Bacteria 1233
63 Ga0157370_10209111 3300013104 Bacteria 1809
64 Ga0157369_10437265 3300013105 Unclassified 1355
65 Ga0157369_10505874 3300013105 Bacteria 1250
66 Ga0163162_13173649 3300013306 Unclassified 527
67 Ga0157372_11553664 3300013307 Unclassified 762
68 Ga0157372_11987940 3300013307 Bacteria 668
69 Ga0157375_10173992 3300013308 Bacteria 2302
70 Ga0157375_10702885 3300013308 Bacteria 1164
71 Ga0163163_11569779 3300014325 Unclassified 719
72 Ga0157380_10547884 3300014326 Bacteria 1134
73 Ga0157380_10981735 3300014326 Bacteria 877
74 Ga0207643_10572082 3300025908 Unclassified 726
75 Ga0207684_10037711 3300025910 Bacteria 4101
76 Ga0207660_10952264 3300025917 Unclassified 700
77 Ga0207659_10089546 3300025926 Bacteria 2295
78 Ga0207709_10316496 3300025935 Bacteria 1166
79 Ga0207670_10763236 3300025936 Unclassified 804
80 Ga0207691_10108851 3300025940 Bacteria 2466
81 Ga0207711_10242681 3300025941 Bacteria 1652
82 Ga0207711_11019781 3300025941 Unclassified 767
83 Ga0207679_10290191 3300025945 Bacteria 1406
84 Ga0207651_10385175 3300025960 Unclassified 1189
85 Ga0207712_10229832 3300025961 Bacteria 1488
86 Ga0207668_10092000 3300025972 Bacteria 2231
87 Ga0207703_10753518 3300026035 Bacteria 928
88 Ga0207702_10003522 3300026078 Bacteria 14267
89 Ga0207648_10176358 3300026089 Bacteria 1890
90 Ga0207674_10610475 3300026116 Bacteria 1054
91 Ga0207428_10001070 3300027907 Bacteria 30013
92 Ga0268264_10574546 3300028381 Bacteria 1108
93 Ga0307408_100476367 3300031548 Bacteria 1088
94 Ga0307408_101061958 3300031548 Unclassified 749
95 Ga0307413_10361771 3300031824 Unclassified 1124
96 Ga0307410_10183427 3300031852 Bacteria 1586
97 Ga0307410_10200109 3300031852 Bacteria 1524
98 Ga0307406_10800915 3300031901 Unclassified 795
99 Ga0307406_11331563 3300031901 Unclassified 628
100 Ga0307412_10418471 3300031911 Bacteria 1096
101 Ga0307409_100393811 3300031995 Unclassified 1321
102 Ga0307416_100357536 3300032002 Bacteria 1481
103 Ga0307416_103338739 3300032002 Unclassified 537
104 Ga0307411_10478194 3300032005 Bacteria 1048
105 Ga0316574_0711812 3300035398 Unclassified 615
106 Ga0373927_0023269 3300035695 Bacteria 4058
107 Ga0373925_0295488 3300037068 Bacteria 1307
108 Ga0466959_0007899 3300045049 Bacteria 7491
109 Ga0466967_0460417 3300045976 Bacteria 1244
110 Ga0495582_0066141 3300046473 Bacteria 1997
111 Ga0495582_0143017 3300046473 Bacteria 1356
112 Ga0495662_0157717 3300046476 Bacteria 1118
113 Ga0495630_0067463 3300046517 Bacteria 2689
114 Ga0495663_0186070 3300046525 Bacteria 721
115 Ga0495586_0020158 3300046535 Bacteria 3551
116 Ga0495659_0228177 3300046664 Bacteria 771
117 Ga0495588_0233354 3300046674 Unclassified 971
118 Ga0495581_0022747 3300047315 Bacteria 3630
119 Ga0495674_0017871 3300047319 Bacteria 6603
120 Ga0495672_0003796 3300047320 Bacteria 12716
121 Ga0495684_0722387 3300047471 Bacteria 658
122 Ga0495593_0371542 3300047673 Bacteria 715
123 Ga0496114_0182312 3300048917 Unclassified 1834
124 Ga0501295_141982 3300049518 Unclassified 589
125 Ga0501031_0461104 3300049568 Bacteria 821
126 Ga0501033_0416106 3300049570 Unclassified 936
127 Ga0501034_0138259 3300049571 Bacteria 2416
128 Ga0501043_0023864 3300049579 Bacteria 4798
129 Ga0501047_0248674 3300049581 Bacteria 1627
130 Ga0501069_0610325 3300049585 Unclassified 655
131 Ga0501072_1444873 3300049588 Unclassified 531
132 Ga0501249_050541 3300049679 Unclassified 954
133 Ga0501079_0416098 3300049741 Bacteria 1055
134 Ga0501268_092290 3300049765 Bacteria 639
135 Ga0501035_0069526 3300049822 Bacteria 3121
136 Ga0501044_0125258 3300049823 Bacteria 2567
137 nmdc:mga09592_34109_c1 3300050508 Bacteria 4254
138 nmdc:mga06r32_214522_c1 3300050510 Bacteria 1912
139 nmdc:mga08y16_261505_c1 3300050511 Bacteria 1787
140 nmdc:mga08y16_90178_c1 3300050511 Bacteria 3195
141 nmdc:mga0rr50_136055_c1 3300050513 Unclassified 1972
142 nmdc:mga0rr50_724072_c1 3300050513 Unclassified 849
143 nmdc:mga0a205_648247_c1 3300050515 Bacteria 907
144 Ga0307413_10079310
145 Ga0065704_10027418
146 Ga0065704_10343507
147 Ga0065712_10006275
148 Ga0065715_10697769
149 Ga0065707_10319053
150 Ga0070658_10622625
151 Ga0070683_100027905
152 Ga0070677_10328097
153 Ga0070680_100232831
154 Ga0070689_100871547
155 Ga0070668_100061016
156 Ga0070675_100350908
157 Ga0070675_101156525
158 Ga0070674_100746265
159 Ga0070667_100027745
160 Ga0070667_100362893
161 Ga0070701_10266505
162 Ga0070700_100386514
163 Ga0070678_100569933
164 Ga0070662_100716589
165 Ga0068867_100471653
166 Ga0068867_100819664
167 Ga0070706_100095039
168 Ga0070698_100018518
169 Ga0070698_100561048
170 Ga0070698_100710697
171 Ga0070699_100151091
172 Ga0070684_100004858
173 Ga0070697_100089322
174 Ga0070672_101230851
175 Ga0070686_100261670
176 Ga0070696_100002322
177 Ga0070696_100079495
178 Ga0070696_100245011
179 Ga0070665_101062687
180 Ga0068857_100085987
181 Ga0068856_100006161
182 Ga0068859_100048787
183 Ga0068859_101181619
184 Ga0068870_10195280
185 Ga0068870_10670475
186 Ga0068860_100497878
187 Ga0068862_100186931
188 Ga0097621_100940651
189 Ga0075431_100032926
190 Ga0075433_10805325
191 Ga0075429_100161156
192 Ga0097620_100048787
193 Ga0097620_101181549
194 Ga0075435_100129306
195 Ga0075435_100616784
196 Ga0111539_10221265
197 Ga0111539_11247762
198 Ga0105247_11109816
199 Ga0105243_10607892
200 Ga0105248_10827318
201 Ga0105238_11717830
202 Ga0105249_10065572
203 Ga0105249_11575380
204 Ga0105239_11944983
205 Ga0105246_10335899
206 Ga0157370_10209111
207 Ga0157369_10437265
208 Ga0157369_10505874
209 Ga0163162_13173649
210 Ga0157372_11553664
211 Ga0157372_11987940
212 Ga0157375_10173992
213 Ga0157375_10702885
214 Ga0163163_11569779
215 Ga0157380_10547884
216 Ga0157380_10981735
217 Ga0207643_10572082
218 Ga0207684_10037711
219 Ga0207660_10952264
220 Ga0207659_10089546
221 Ga0207709_10316496
222 Ga0207670_10763236
223 Ga0207691_10108851
224 Ga0207711_10242681
225 Ga0207711_11019781
226 Ga0207679_10290191
227 Ga0207651_10385175
228 Ga0207712_10229832
229 Ga0207668_10092000
230 Ga0207703_10753518
231 Ga0207702_10003522
232 Ga0207648_10176358
233 Ga0207674_10610475
234 Ga0207428_10001070
235 Ga0268264_10574546
236 Ga0307408_100476367
237 Ga0307408_101061958
238 Ga0307413_10361771
239 Ga0307410_10183427
240 Ga0307410_10200109
241 Ga0307406_10800915
242 Ga0307406_11331563
243 Ga0307412_10418471
244 Ga0307409_100393811
245 Ga0307416_100357536
246 Ga0307416_103338739
247 Ga0307411_10478194
248 Ga0316574_0711812
249 Ga0373927_0023269
250 Ga0373925_0295488
251 Ga0466959_0007899
252 Ga0466967_0460417
253 Ga0495582_0066141
254 Ga0495582_0143017
255 Ga0495662_0157717
256 Ga0495630_0067463
257 Ga0495663_0186070
258 Ga0495586_0020158
259 Ga0495659_0228177
260 Ga0495588_0233354
261 Ga0495581_0022747
262 Ga0495674_0017871
263 Ga0495672_0003796
264 Ga0495684_0722387
265 Ga0495593_0371542
266 Ga0496114_0182312
267 Ga0501295_141982
268 Ga0501031_0461104
269 Ga0501033_0416106
270 Ga0501034_0138259
271 Ga0501043_0023864
272 Ga0501047_0248674
273 Ga0501069_0610325
274 Ga0501072_1444873
275 Ga0501249_050541
276 Ga0501079_0416098
277 Ga0501268_092290
278 Ga0501035_0069526
279 Ga0501044_0125258
280 nmdc:mga09592_34109_c1
281 nmdc:mga06r32_214522_c1
282 nmdc:mga08y16_261505_c1
283 nmdc:mga08y16_90178_c1
284 nmdc:mga0rr50_136055_c1
285 nmdc:mga0rr50_724072_c1
286 nmdc:mga0a205_648247_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hkv-assembly1.cif.gz_A-2 crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution 0.5278 5 141
5wk0-assembly1.cif.gz_A-2 crystal structure of the bacillithiol transferase bsta from staphylococcus aureus. 0.5006 1 140
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.4918 5 145
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.488 4 142
2nsf-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase 0.4863 1 145
ID Description Score Start End Superfamily
af_P72040_13_192_1.10.30.50 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.5818 4 145 1.10.30.50
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.565 4 145 1.20.120.450
af_O05777_10_164_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.5512 8 143 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.545 4 145 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.5333 5 141 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2V7S499-F1-model_v4 DUF1569 domain-containing protein 0.9826 1 145
AF-A0A2V7S499-F1-model_v4 DUF1569 domain-containing protein 0.9759 1 145
AF-A0A7Y5V4B6-F1-model_v4 DinB family protein 0.9744 1 145
AF-A0A538SJV5-F1-model_v4 DUF1569 domain-containing protein 0.9695 1 145
AF-A0A7Y5V4B6-F1-model_v4 DinB family protein 0.9679 1 145

Map