F188607

General Info

Members Datasets Scaffolds Average Seq Length
143 116 286 227

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10670493|Ga0114129_106704932
Length 265
Sequence MLFVGARFSADLPAQGADRSGWRPGQSDTDRFRRELLMKGLRKRVLLSWSSGKDSAWALHVLRQRPDVELAGLLTTINERFDRVAMHAVRTDLLRRQADSVGLPLRLISLPFQCGNEVYEERIRAAIGAAQADGVEGIAFGDLFLADVRQYREKMMEGTGITPLFPLWGRPTAELAREMTAGGLRAQITCIDPRSLPASMSGREYNGDFLKALPEGVDPCGENGEFHSFAFDGPMFNRPVEFTVGETVERVGFVFTDLAPVSPRL

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
58 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
59 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
60 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
61 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
66 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
71 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
72 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
83 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
89 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
98 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
99 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
100 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
101 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
102 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
103 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
107 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
108 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
109 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
110 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
111 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
112 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
113 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
114 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
115 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
116 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.01
Metatranscriptomes 2.1
Isolates 4.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.1
Nodule 2.1
Rhizoplane 2.8
Rhizosphere 90.91
Stem 0
Stem Tuber 0
Unclassified 8.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10670493 3300009147 Bacteria 1336
2 MBSR1b_contig_11326443 2162886012 Bacteria 1441
3 JGI25152J39213_1000075 3300002773 Bacteria 66427
4 JGI25404J52841_10003775 3300003659 Bacteria 3022
5 Ga0065715_10112310 3300005293 Bacteria 2535
6 Ga0070658_10080897 3300005327 Bacteria 2668
7 Ga0070660_100008523 3300005339 Bacteria 7177
8 Ga0070675_100725655 3300005354 Unclassified 906
9 Ga0070659_100036493 3300005366 Bacteria 3832
10 Ga0070667_100048766 3300005367 Bacteria 3565
11 Ga0070709_10002114 3300005434 Bacteria 10748
12 Ga0070709_10097354 3300005434 Unclassified 1953
13 Ga0070711_100086662 3300005439 Bacteria 2246
14 Ga0070700_100153119 3300005441 Bacteria 1579
15 Ga0070708_100011186 3300005445 Bacteria 7298
16 Ga0070663_100075541 3300005455 Bacteria 2463
17 Ga0070706_100033868 3300005467 Bacteria 4715
18 Ga0070707_100000064 3300005468 Bacteria 96008
19 Ga0070707_100005356 3300005468 Bacteria 12008
20 Ga0070707_100013106 3300005468 Bacteria 7749
21 Ga0068855_100011259 3300005563 Bacteria 10803
22 Ga0081455_10002948 3300005937 Bacteria 19919
23 Ga0081455_10021895 3300005937 Bacteria 5986
24 Ga0081540_1005908 3300005983 Bacteria 9033
25 Ga0081540_1017774 3300005983 Bacteria 4391
26 Ga0081540_1019906 3300005983 Bacteria 4057
27 Ga0075367_10208354 3300006178 Bacteria 1222
28 Ga0075428_100430993 3300006844 Bacteria 1413
29 Ga0075428_100432065 3300006844 Bacteria 1411
30 Ga0075428_100581825 3300006844 Bacteria 1196
31 Ga0075431_100056154 3300006847 Bacteria 4061
32 Ga0075431_100062894 3300006847 Unclassified 3830
33 Ga0075431_100195463 3300006847 Bacteria 2071
34 Ga0075431_100318180 3300006847 Unclassified 1570
35 Ga0075433_10133976 3300006852 Bacteria 2202
36 Ga0075433_10279385 3300006852 Bacteria 1479
37 Ga0075429_100007199 3300006880 Bacteria 9653
38 Ga0075436_100030343 3300006914 Bacteria 3722
39 Ga0075435_100340249 3300007076 Bacteria 1286
40 Ga0105240_10015490 3300009093 Bacteria 10364
41 Ga0111539_10454606 3300009094 Bacteria 1491
42 Ga0111539_10546555 3300009094 Bacteria 1349
43 Ga0111539_10847214 3300009094 Bacteria 1064
44 Ga0114129_10102255 3300009147 Bacteria 3963
45 Ga0105241_10097461 3300009174 Bacteria 2331
46 Ga0105238_10055549 3300009551 Bacteria 3974
47 Ga0157371_10086828 3300013102 Bacteria 2215
48 Ga0157370_10068064 3300013104 Bacteria 3365
49 Ga0157370_10296165 3300013104 Bacteria 1494
50 Ga0157370_10320675 3300013104 Unclassified 1429
51 Ga0157369_10109469 3300013105 Bacteria 2937
52 Ga0157372_10163731 3300013307 Bacteria 2571
53 Ga0207697_10017479 3300025315 Bacteria 2947
54 Ga0207688_10187434 3300025901 Bacteria 1236
55 Ga0207705_10000646 3300025909 Bacteria 29012
56 Ga0207707_10004218 3300025912 Bacteria 12723
57 Ga0207695_10039707 3300025913 Bacteria 5055
58 Ga0207660_10012235 3300025917 Bacteria 5608
59 Ga0207657_10099614 3300025919 Bacteria 2414
60 Ga0207657_10143236 3300025919 Bacteria 1951
61 Ga0207652_10102517 3300025921 Bacteria 2529
62 Ga0207646_10000207 3300025922 Bacteria 80239
63 Ga0207694_10490468 3300025924 Bacteria 1028
64 Ga0207706_10449654 3300025933 Bacteria 1114
65 Ga0207669_10267093 3300025937 Bacteria 1283
66 Ga0207667_10032694 3300025949 Bacteria 5602
67 Ga0207667_10090522 3300025949 Bacteria 3162
68 Ga0207640_10113191 3300025981 Bacteria 1928
69 Ga0207658_10283382 3300025986 Bacteria 1421
70 Ga0207678_10052056 3300026067 Bacteria 3533
71 Ga0207708_10197077 3300026075 Bacteria 1605
72 Ga0207702_10049981 3300026078 Bacteria 3529
73 Ga0207641_10798986 3300026088 Bacteria 933
74 Ga0207648_10154012 3300026089 Unclassified 2029
75 Ga0207428_10016795 3300027907 Bacteria 6292
76 Ga0265354_1000664 3300028016 Bacteria 5712
77 Ga0265357_1000301 3300028023 Unclassified 2624
78 Ga0265355_1001995 3300028036 Bacteria 1389
79 Ga0307515_10434453 3300028794 Bacteria 930
80 Ga0265763_1003631 3300030763 Bacteria 1236
81 Ga0265770_1000118 3300030878 Bacteria 9442
82 Ga0265760_10000054 3300031090 Bacteria 32883
83 Ga0265314_10010416 3300031711 Bacteria 7756
84 Ga0316576_10095045 3300031727 Bacteria 2223
85 Ga0316577_10384002 3300031733 Bacteria 798
86 Ga0307416_100192631 3300032002 Bacteria 1925
87 Ga0307414_10012880 3300032004 Bacteria 4963
88 Ga0307414_10224165 3300032004 Bacteria 1545
89 Ga0373923_0073298 3300035111 Bacteria 1474
90 Ga0373954_0184684 3300035118 Unclassified 1023
91 Ga0373946_0099398 3300035171 Bacteria 1302
92 Ga0316574_0001179 3300035398 Bacteria 12105
93 Ga0373935_0021519 3300035692 Bacteria 3949
94 Ga0373947_0007457 3300035725 Bacteria 6332
95 Ga0373937_0016607 3300036401 Bacteria 6539
96 Ga0316584_0158085 3300036712 Bacteria 1685
97 Ga0373925_0233928 3300037068 Bacteria 1470
98 Ga0373925_0252135 3300037068 Unclassified 1416
99 Ga0395900_0508215 3300037418 Bacteria 1154
100 Ga0395898_0124809 3300037466 Bacteria 2466
101 Ga0451807_2690329 3300041486 Bacteria 612
102 Ga0466963_0152659 3300044694 Bacteria 1604
103 Ga0453684_0292111 3300044712 Bacteria 1856
104 Ga0466971_0083106 3300044719 Bacteria 1462
105 Ga0466959_0100436 3300045049 Bacteria 2071
106 Ga0451576_0113483 3300045051 Bacteria 2821
107 Ga0466958_0298457 3300045836 Bacteria 1034
108 Ga0466967_0084646 3300045976 Bacteria 2870
109 Ga0495584_0097252 3300046491 Bacteria 1487
110 Ga0495647_0137696 3300046681 Bacteria 1039
111 Ga0496102_0322662 3300048905 Bacteria 1455
112 Ga0496109_0000073 3300048912 Bacteria 107495
113 Ga0496110_0746344 3300048913 Bacteria 882
114 Ga0501033_0247448 3300049570 Bacteria 1264
115 Ga0501034_0042322 3300049571 Bacteria 4611
116 Ga0501036_0146791 3300049572 Bacteria 1990
117 Ga0501040_0574218 3300049576 Bacteria 814
118 Ga0501225_0000278 3300049705 Bacteria 16150
119 Ga0501080_0131519 3300049742 Bacteria 2317
120 Ga0501081_0338562 3300049743 Bacteria 1108
121 nmdc:mga06z11_177255_c1 3300050494 Bacteria 1227
122 nmdc:mga05p37_127581_c1 3300050507 Bacteria 3123
123 nmdc:mga05p37_493533_c2 3300050507 Bacteria 981
124 nmdc:mga09592_102139_c1 3300050508 Bacteria 2457
125 nmdc:mga09592_786086_c1 3300050508 Bacteria 806
126 nmdc:mga0qj67_50290_c1 3300050509 Bacteria 3295
127 nmdc:mga06r32_180592_c1 3300050510 Bacteria 2096
128 nmdc:mga06r32_31539_c1 3300050510 Bacteria 4979
129 nmdc:mga06r32_340995_c1 3300050510 Unclassified 1483
130 nmdc:mga06r32_36220_c1 3300050510 Bacteria 4661
131 nmdc:mga06r32_537206_c1 3300050510 Unclassified 1144
132 nmdc:mga08y16_43386_c1 3300050511 Unclassified 4713
133 nmdc:mga0n895_174017_c1 3300050512 Bacteria 2184
134 nmdc:mga08x19_24955_c1 3300050514 Bacteria 3721
135 nmdc:mga0a205_298114_c1 3300050515 Bacteria 1485
136 Ga0501082_0482200 3300060353 Bacteria 1084
137 2513695041 2513237101 Bacteria 7952346
138 2874608140 2874604998 Bacteria 7834745
139 2919495248 2919493220 Bacteria 4598500
140 2919545515 2919543075 Bacteria 4728703
141 3006977486 3006973921 Bacteria 4423788
142 8006969292 8006964411 Bacteria 8966052
143 8054477160 8054472261 Bacteria 7464355
144 Ga0114129_10670493
145 MBSR1b_contig_11326443
146 JGI25152J39213_1000075
147 JGI25404J52841_10003775
148 Ga0065715_10112310
149 Ga0070658_10080897
150 Ga0070660_100008523
151 Ga0070675_100725655
152 Ga0070659_100036493
153 Ga0070667_100048766
154 Ga0070709_10002114
155 Ga0070709_10097354
156 Ga0070711_100086662
157 Ga0070700_100153119
158 Ga0070708_100011186
159 Ga0070663_100075541
160 Ga0070706_100033868
161 Ga0070707_100000064
162 Ga0070707_100005356
163 Ga0070707_100013106
164 Ga0068855_100011259
165 Ga0081455_10002948
166 Ga0081455_10021895
167 Ga0081540_1005908
168 Ga0081540_1017774
169 Ga0081540_1019906
170 Ga0075367_10208354
171 Ga0075428_100430993
172 Ga0075428_100432065
173 Ga0075428_100581825
174 Ga0075431_100056154
175 Ga0075431_100062894
176 Ga0075431_100195463
177 Ga0075431_100318180
178 Ga0075433_10133976
179 Ga0075433_10279385
180 Ga0075429_100007199
181 Ga0075436_100030343
182 Ga0075435_100340249
183 Ga0105240_10015490
184 Ga0111539_10454606
185 Ga0111539_10546555
186 Ga0111539_10847214
187 Ga0114129_10102255
188 Ga0105241_10097461
189 Ga0105238_10055549
190 Ga0157371_10086828
191 Ga0157370_10068064
192 Ga0157370_10296165
193 Ga0157370_10320675
194 Ga0157369_10109469
195 Ga0157372_10163731
196 Ga0207697_10017479
197 Ga0207688_10187434
198 Ga0207705_10000646
199 Ga0207707_10004218
200 Ga0207695_10039707
201 Ga0207660_10012235
202 Ga0207657_10099614
203 Ga0207657_10143236
204 Ga0207652_10102517
205 Ga0207646_10000207
206 Ga0207694_10490468
207 Ga0207706_10449654
208 Ga0207669_10267093
209 Ga0207667_10032694
210 Ga0207667_10090522
211 Ga0207640_10113191
212 Ga0207658_10283382
213 Ga0207678_10052056
214 Ga0207708_10197077
215 Ga0207702_10049981
216 Ga0207641_10798986
217 Ga0207648_10154012
218 Ga0207428_10016795
219 Ga0265354_1000664
220 Ga0265357_1000301
221 Ga0265355_1001995
222 Ga0307515_10434453
223 Ga0265763_1003631
224 Ga0265770_1000118
225 Ga0265760_10000054
226 Ga0265314_10010416
227 Ga0316576_10095045
228 Ga0316577_10384002
229 Ga0307416_100192631
230 Ga0307414_10012880
231 Ga0307414_10224165
232 Ga0373923_0073298
233 Ga0373954_0184684
234 Ga0373946_0099398
235 Ga0316574_0001179
236 Ga0373935_0021519
237 Ga0373947_0007457
238 Ga0373937_0016607
239 Ga0316584_0158085
240 Ga0373925_0233928
241 Ga0373925_0252135
242 Ga0395900_0508215
243 Ga0395898_0124809
244 Ga0451807_2690329
245 Ga0466963_0152659
246 Ga0453684_0292111
247 Ga0466971_0083106
248 Ga0466959_0100436
249 Ga0451576_0113483
250 Ga0466958_0298457
251 Ga0466967_0084646
252 Ga0495584_0097252
253 Ga0495647_0137696
254 Ga0496102_0322662
255 Ga0496109_0000073
256 Ga0496110_0746344
257 Ga0501033_0247448
258 Ga0501034_0042322
259 Ga0501036_0146791
260 Ga0501040_0574218
261 Ga0501225_0000278
262 Ga0501080_0131519
263 Ga0501081_0338562
264 nmdc:mga06z11_177255_c1
265 nmdc:mga05p37_127581_c1
266 nmdc:mga05p37_493533_c2
267 nmdc:mga09592_102139_c1
268 nmdc:mga09592_786086_c1
269 nmdc:mga0qj67_50290_c1
270 nmdc:mga06r32_180592_c1
271 nmdc:mga06r32_31539_c1
272 nmdc:mga06r32_340995_c1
273 nmdc:mga06r32_36220_c1
274 nmdc:mga06r32_537206_c1
275 nmdc:mga08y16_43386_c1
276 nmdc:mga0n895_174017_c1
277 nmdc:mga08x19_24955_c1
278 nmdc:mga0a205_298114_c1
279 Ga0501082_0482200
280 2513695041
281 2874608140
282 2919495248
283 2919545515
284 3006977486
285 8006969292
286 8054477160

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01902

Diphthami_syn_2

Diphthamide synthase

43

259

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d13-assembly1.cif.gz_A crystal structure of ph1257 from pyrococcus horikoshii ot3 0.8595 2 221
2d13-assembly1.cif.gz_C crystal structure of ph1257 from pyrococcus horikoshii ot3 0.8414 2 221
3rjz-assembly1.cif.gz_A-2 x-ray crystal structure of the putative n-type atp pyrophosphatase from pyrococcus furiosus, the northeast structural genomics target pfr23 0.838 2 219
3rk1-assembly1.cif.gz_A 'x-ray crystal structure of the putative n-type atp pyrophosphatase (pf0828) in complex with atp from pyrococcus furiosus, northeast structural genomics consortium target pfr23 0.8239 1 216
2d13-assembly1.cif.gz_A crystal structure of ph1257 from pyrococcus horikoshii ot3 0.8187 2 221
ID Description Score Start End Superfamily
2d13C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8664 2 128 3.40.50.620
2d13C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8373 2 128 3.40.50.620
af_Q9VC52_1_473_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8129 1 32 3.50.50.60
2d13D02 Alpha Beta;Alpha-Beta Complex;putative n-type atp pyrophosphatase, domain 2;putative n-type atp pyrophosphatase, domain 2 0.8105 133 220 3.90.1490.10
af_Q12429_1_157_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7953 1 141 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A2V8GYZ4-F1-model_v4 ATP-binding protein 0.9935 1 221 GO:0005524
AF-A0A537QRI7-F1-model_v4 Adenine nucleotide alpha hydrolase 0.9911 6 220 GO:0016787
AF-A0A3C2C382-F1-model_v4 ATP-binding protein 0.9911 33 217 GO:0005524
AF-A0A2M9ZT28-F1-model_v4 Diphthamide synthase domain-containing protein 0.989 1 220
AF-A0A3A8NE51-F1-model_v4 Adenine nucleotide alpha hydrolase 0.9885 2 223 GO:0016787

Map