F188250

General Info

Members Datasets Scaffolds Average Seq Length
143 90 286 296

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100108109|Ga0068863_1001081092
Length 356
Sequence VRRYPHLFFWVWRFEIWNFSGAWGLALGDSIGAGFVIEMRRRIFVEKNRAFDQLGVRTKQPTTPTMKKRLLAAGLVSICISMQAEISDAVPLWSEGAPGALGKEDKDVPTLTLYSPEPDKATGSALVVCPGGGYGGLAPHEGRDYALWLNEHGIAAFVLKYRLGSNGYRHPAMLNDAARAVRLVRAKATEWKIDPHRVGIMGSSAGGHLASTLLTHFDTGKPDAADPIERQSSRPDIGILCYPVITMGEHTHAGSKNNLLGKDPSPELVKSLSNELQVTKATPACFLFHTYEDPAVPVENSLDFAAALRKAGVPFDLHVYQKGRHGIGLGDKPPFGHVHPWAMDCLVWLKEQGWVK

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
38 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
39 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
40 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
41 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
42 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
43 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
44 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
45 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
46 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
47 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
48 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
49 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
50 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
51 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
52 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
55 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
56 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
57 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
58 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
59 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
60 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
61 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
62 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
63 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
64 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
65 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
66 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
67 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
68 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
69 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
70 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
71 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
72 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
73 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
74 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
75 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
83 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
85 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
86 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
87 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
88 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
89 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
90 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 97.2
Stem 0
Stem Tuber 0
Unclassified 16.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100108109 3300005841 Bacteria 2647
2 rootH1_10069332 3300003316 Bacteria 1652
3 rootH2_10082941 3300003320 Bacteria 11158
4 rootL2_10081475 3300003322 Bacteria 7604
5 rootL2_10352573 3300003322 Unclassified 1239
6 Ga0070658_10025775 3300005327 Bacteria 4713
7 Ga0070690_100001242 3300005330 Bacteria 13231
8 Ga0070690_100032854 3300005330 Unclassified 3244
9 Ga0070670_100136971 3300005331 Bacteria 2116
10 Ga0070689_100007808 3300005340 Bacteria 7496
11 Ga0070689_100040974 3300005340 Bacteria 3553
12 Ga0070689_100052023 3300005340 Unclassified 3167
13 Ga0070689_100129816 3300005340 Bacteria 2020
14 Ga0070674_100131850 3300005356 Bacteria 1864
15 Ga0070688_100008584 3300005365 Bacteria 5557
16 Ga0070708_100058419 3300005445 Bacteria 3437
17 Ga0070685_10074593 3300005466 Unclassified 2019
18 Ga0068855_100025520 3300005563 Bacteria 7070
19 Ga0068857_100000877 3300005577 Bacteria 22689
20 Ga0068857_100049644 3300005577 Unclassified 3723
21 Ga0068859_100078176 3300005617 Bacteria 3349
22 Ga0068859_100234364 3300005617 Bacteria 1924
23 Ga0068859_100470062 3300005617 Unclassified 1353
24 Ga0068864_100323574 3300005618 Bacteria 1449
25 Ga0068858_100353293 3300005842 Bacteria 1408
26 Ga0068871_100033730 3300006358 Bacteria 4056
27 Ga0075428_100001336 3300006844 Bacteria 26156
28 Ga0075428_100042352 3300006844 Bacteria 5006
29 Ga0075429_100035754 3300006880 Bacteria 4321
30 Ga0097620_100078176 3300006931 Bacteria 3349
31 Ga0097620_100234360 3300006931 Bacteria 1924
32 Ga0097620_100470008 3300006931 Unclassified 1353
33 Ga0111539_10009209 3300009094 Bacteria 12481
34 Ga0111539_10039225 3300009094 Bacteria 5710
35 Ga0111539_10047068 3300009094 Bacteria 5157
36 Ga0111539_10080136 3300009094 Unclassified 3841
37 Ga0111539_10606295 3300009094 Unclassified 1275
38 Ga0157374_10420131 3300013296 Bacteria 1336
39 Ga0157372_10278306 3300013307 Unclassified 1945
40 Ga0163163_10034825 3300014325 Bacteria 4880
41 Ga0207705_10048513 3300025909 Bacteria 3054
42 Ga0207663_10007955 3300025916 Bacteria 5531
43 Ga0207681_10261143 3300025923 Bacteria 1356
44 Ga0207700_10109607 3300025928 Bacteria 2219
45 Ga0207670_10002095 3300025936 Bacteria 10426
46 Ga0207670_10022244 3300025936 Unclassified 3927
47 Ga0207670_10255975 3300025936 Bacteria 1355
48 Ga0207704_10136981 3300025938 Unclassified 1706
49 Ga0207667_10049889 3300025949 Unclassified 4418
50 Ga0207703_10043383 3300026035 Bacteria 3610
51 Ga0207702_10000448 3300026078 Bacteria 46553
52 Ga0207676_10186840 3300026095 Bacteria 1820
53 Ga0207674_10002625 3300026116 Bacteria 22499
54 Ga0207674_10152439 3300026116 Unclassified 2268
55 Ga0265337_1037917 3300028556 Bacteria 1399
56 Ga0265326_10013756 3300028558 Bacteria 2363
57 Ga0265323_10000031 3300028653 Bacteria 77683
58 Ga0265336_10009698 3300028666 Bacteria 3322
59 Ga0265338_10000959 3300028800 Bacteria 48640
60 Ga0265338_10001283 3300028800 Bacteria 41225
61 Ga0265338_10015814 3300028800 Bacteria 8262
62 Ga0265338_10016687 3300028800 Bacteria 7960
63 Ga0265338_10051388 3300028800 Unclassified 3711
64 Ga0265338_10088553 3300028800 Unclassified 2568
65 Ga0265338_10168333 3300028800 Bacteria 1684
66 Ga0265324_10002489 3300029957 Bacteria 9358
67 Ga0265324_10007982 3300029957 Bacteria 4241
68 Ga0265324_10067877 3300029957 Bacteria 1216
69 Ga0265320_10001359 3300031240 Bacteria 17838
70 Ga0265320_10008653 3300031240 Bacteria 6207
71 Ga0265320_10019375 3300031240 Bacteria 3721
72 Ga0265329_10001708 3300031242 Bacteria 10507
73 Ga0265327_10004147 3300031251 Bacteria 13077
74 Ga0265316_10044854 3300031344 Bacteria 3513
75 Ga0265316_10103111 3300031344 Unclassified 2166
76 Ga0307408_100000031 3300031548 Bacteria 214210
77 Ga0265314_10003275 3300031711 Bacteria 15820
78 Ga0265314_10035843 3300031711 Bacteria 3613
79 Ga0265342_10129772 3300031712 Bacteria 1413
80 Ga0316576_10119992 3300031727 Bacteria 1974
81 Ga0316578_10134177 3300031728 Bacteria 1490
82 Ga0307407_10000111 3300031903 Bacteria 26379
83 Ga0307416_100025025 3300032002 Bacteria 4368
84 Ga0316574_0195072 3300035398 Bacteria 1302
85 Ga0373933_0019200 3300035724 Bacteria 3857
86 Ga0373937_0005830 3300036401 Bacteria 10590
87 Ga0373937_0369891 3300036401 Bacteria 1359
88 Ga0451577_0070170 3300042876 Unclassified 3125
89 Ga0453684_0473796 3300044712 Bacteria 1390
90 Ga0451576_0000529 3300045051 Bacteria 82682
91 Ga0451576_0029975 3300045051 Bacteria 5818
92 Ga0451576_0121306 3300045051 Bacteria 2722
93 Ga0451576_0132165 3300045051 Bacteria 2602
94 Ga0451576_0527230 3300045051 Bacteria 1241
95 Ga0495630_0000036 3300046517 Bacteria 116547
96 Ga0495666_0002515 3300046526 Bacteria 9103
97 Ga0495665_0149154 3300046531 Bacteria 1221
98 Ga0495640_0032727 3300046533 Bacteria 3700
99 Ga0495586_0000046 3300046535 Bacteria 73506
100 Ga0495645_0063448 3300046543 Bacteria 2675
101 Ga0495667_0074759 3300046559 Bacteria 2206
102 Ga0495667_0104645 3300046559 Bacteria 1830
103 Ga0495634_0007527 3300046642 Bacteria 8163
104 Ga0495634_0017502 3300046642 Bacteria 5112
105 Ga0495658_0034714 3300046683 Bacteria 2769
106 Ga0495613_0125038 3300046689 Bacteria 1845
107 Ga0495624_0035149 3300046690 Bacteria 3236
108 Ga0495600_0198423 3300046809 Unclassified 1289
109 Ga0495674_0002178 3300047319 Bacteria 19240
110 Ga0495680_0071267 3300047322 Bacteria 2647
111 Ga0495684_0062887 3300047471 Bacteria 2823
112 Ga0495684_0348581 3300047471 Unclassified 1052
113 Ga0501031_0000043 3300049568 Bacteria 67296
114 Ga0501031_0120970 3300049568 Bacteria 1710
115 Ga0501032_0000139 3300049569 Bacteria 59150
116 Ga0501032_0071959 3300049569 Bacteria 2304
117 Ga0501032_0109766 3300049569 Bacteria 1826
118 Ga0501033_0000009 3300049570 Bacteria 272351
119 Ga0501033_0002652 3300049570 Bacteria 15043
120 Ga0501033_0028927 3300049570 Bacteria 4164
121 Ga0501034_0004693 3300049571 Bacteria 15130
122 Ga0501037_0000058 3300049573 Bacteria 101525
123 Ga0501037_0034555 3300049573 Bacteria 3731
124 Ga0501037_0212917 3300049573 Bacteria 1362
125 Ga0501043_0000196 3300049579 Bacteria 55069
126 Ga0501043_0280981 3300049579 Bacteria 1276
127 Ga0501047_0001427 3300049581 Bacteria 23472
128 Ga0501047_0058550 3300049581 Bacteria 3722
129 Ga0501080_0030266 3300049742 Bacteria 5043
130 Ga0501035_0024892 3300049822 Bacteria 5489
131 Ga0501035_0037786 3300049822 Bacteria 4370
132 Ga0501044_0000032 3300049823 Bacteria 169439
133 Ga0501044_0000550 3300049823 Bacteria 45596
134 Ga0501044_0005209 3300049823 Bacteria 14476
135 Ga0501044_0105158 3300049823 Unclassified 2836
136 nmdc:mga05p37_707029_c1 3300050507 Bacteria 1118
137 nmdc:mga09592_39867_c1 3300050508 Unclassified 3945
138 nmdc:mga06r32_407479_c1 3300050510 Bacteria 1341
139 nmdc:mga08y16_113760_c1 3300050511 Bacteria 2817
140 nmdc:mga08y16_373691_c1 3300050511 Unclassified 1462
141 nmdc:mga08y16_90970_c1 3300050511 Unclassified 3180
142 nmdc:mga0n895_576623_c1 3300050512 Bacteria 1129
143 Ga0495601_0051471 3300053077 Eukaryota 2599
144 Ga0068863_100108109
145 rootH1_10069332
146 rootH2_10082941
147 rootL2_10081475
148 rootL2_10352573
149 Ga0070658_10025775
150 Ga0070690_100001242
151 Ga0070690_100032854
152 Ga0070670_100136971
153 Ga0070689_100007808
154 Ga0070689_100040974
155 Ga0070689_100052023
156 Ga0070689_100129816
157 Ga0070674_100131850
158 Ga0070688_100008584
159 Ga0070708_100058419
160 Ga0070685_10074593
161 Ga0068855_100025520
162 Ga0068857_100000877
163 Ga0068857_100049644
164 Ga0068859_100078176
165 Ga0068859_100234364
166 Ga0068859_100470062
167 Ga0068864_100323574
168 Ga0068858_100353293
169 Ga0068871_100033730
170 Ga0075428_100001336
171 Ga0075428_100042352
172 Ga0075429_100035754
173 Ga0097620_100078176
174 Ga0097620_100234360
175 Ga0097620_100470008
176 Ga0111539_10009209
177 Ga0111539_10039225
178 Ga0111539_10047068
179 Ga0111539_10080136
180 Ga0111539_10606295
181 Ga0157374_10420131
182 Ga0157372_10278306
183 Ga0163163_10034825
184 Ga0207705_10048513
185 Ga0207663_10007955
186 Ga0207681_10261143
187 Ga0207700_10109607
188 Ga0207670_10002095
189 Ga0207670_10022244
190 Ga0207670_10255975
191 Ga0207704_10136981
192 Ga0207667_10049889
193 Ga0207703_10043383
194 Ga0207702_10000448
195 Ga0207676_10186840
196 Ga0207674_10002625
197 Ga0207674_10152439
198 Ga0265337_1037917
199 Ga0265326_10013756
200 Ga0265323_10000031
201 Ga0265336_10009698
202 Ga0265338_10000959
203 Ga0265338_10001283
204 Ga0265338_10015814
205 Ga0265338_10016687
206 Ga0265338_10051388
207 Ga0265338_10088553
208 Ga0265338_10168333
209 Ga0265324_10002489
210 Ga0265324_10007982
211 Ga0265324_10067877
212 Ga0265320_10001359
213 Ga0265320_10008653
214 Ga0265320_10019375
215 Ga0265329_10001708
216 Ga0265327_10004147
217 Ga0265316_10044854
218 Ga0265316_10103111
219 Ga0307408_100000031
220 Ga0265314_10003275
221 Ga0265314_10035843
222 Ga0265342_10129772
223 Ga0316576_10119992
224 Ga0316578_10134177
225 Ga0307407_10000111
226 Ga0307416_100025025
227 Ga0316574_0195072
228 Ga0373933_0019200
229 Ga0373937_0005830
230 Ga0373937_0369891
231 Ga0451577_0070170
232 Ga0453684_0473796
233 Ga0451576_0000529
234 Ga0451576_0029975
235 Ga0451576_0121306
236 Ga0451576_0132165
237 Ga0451576_0527230
238 Ga0495630_0000036
239 Ga0495666_0002515
240 Ga0495665_0149154
241 Ga0495640_0032727
242 Ga0495586_0000046
243 Ga0495645_0063448
244 Ga0495667_0074759
245 Ga0495667_0104645
246 Ga0495634_0007527
247 Ga0495634_0017502
248 Ga0495658_0034714
249 Ga0495613_0125038
250 Ga0495624_0035149
251 Ga0495600_0198423
252 Ga0495674_0002178
253 Ga0495680_0071267
254 Ga0495684_0062887
255 Ga0495684_0348581
256 Ga0501031_0000043
257 Ga0501031_0120970
258 Ga0501032_0000139
259 Ga0501032_0071959
260 Ga0501032_0109766
261 Ga0501033_0000009
262 Ga0501033_0002652
263 Ga0501033_0028927
264 Ga0501034_0004693
265 Ga0501037_0000058
266 Ga0501037_0034555
267 Ga0501037_0212917
268 Ga0501043_0000196
269 Ga0501043_0280981
270 Ga0501047_0001427
271 Ga0501047_0058550
272 Ga0501080_0030266
273 Ga0501035_0024892
274 Ga0501035_0037786
275 Ga0501044_0000032
276 Ga0501044_0000550
277 Ga0501044_0005209
278 Ga0501044_0105158
279 nmdc:mga05p37_707029_c1
280 nmdc:mga09592_39867_c1
281 nmdc:mga06r32_407479_c1
282 nmdc:mga08y16_113760_c1
283 nmdc:mga08y16_373691_c1
284 nmdc:mga08y16_90970_c1
285 nmdc:mga0n895_576623_c1
286 Ga0495601_0051471

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20434

BD-FAE

BD-FAE

111

308

0.85

PF00326

Peptidase_S9

Prolyl oligopeptidase family

243

339

0.84

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

127

329

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6a6o-assembly1.cif.gz_A crystal structure of acetyl ester-xyloside bifunctional hydrolase from caldicellulosiruptor lactoaceticus 0.9399 22 290
6a6o-assembly1.cif.gz_A crystal structure of acetyl ester-xyloside bifunctional hydrolase from caldicellulosiruptor lactoaceticus 0.913 22 290
7dwc-assembly4.cif.gz_D bacteroides thetaiotaomicron vpi5482 btaxe1 0.9115 44 285
6mly-assembly4.cif.gz_D bifunctional gh43-ce bacteroides eggerthii, bacegg_01304 0.8452 44 262
7bfr-assembly1.cif.gz_A thermogutta terrifontis esterase 2 phosphorylated by paraoxon 0.8328 42 292
ID Description Score Start End Superfamily
af_B4FFC7_103_353_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8174 36 259 3.40.50.1820
af_A0A1D6EGD3_55_198_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8157 60 148 3.40.50.1820
3hxkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8121 29 286 3.40.50.1820
3bjrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8084 43 286 3.40.50.1820
af_Q7JR83_376_566_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8055 54 143 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2V8G3A5-F1-model_v4 Endo-1,4-beta-xylanase 0.9815 104 221 GO:0016798
GO:0045493
AF-A0A2E7LCU9-F1-model_v4 BD-FAE-like domain-containing protein 0.9766 22 248 GO:0016020
GO:0016787
AF-A0A848ASK6-F1-model_v4 Alpha/beta hydrolase 0.9737 18 290 GO:0016787
AF-A0A7Z2VRQ5-F1-model_v4 Alpha/beta hydrolase 0.9651 70 287 GO:0016787
AF-A0A2A2R005-F1-model_v4 BD-FAE-like domain-containing protein 0.9641 22 289 GO:0016787

Map