F188234

General Info

Members Datasets Scaffolds Average Seq Length
143 109 286 414

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100009435|Ga0068864_1000094357
Length 441
Sequence MAQSNWKRGQAPLPELFYSQRSYPRLFWVVGGVLLLLGLLFLAARTVKNRTSQEEGLAPAVKAVQISALGIDAAEPVTAAAGDGTFYVAWVNHEAKQADVMLARFNHDGAMQGSPVRVNRQLGVATAWRGDQPSIAVAPDSAVYVLWTARVEAGGKQGTDVYLSVSNDRGQSFASEVKVNDDKAPGAHGMHSLAVTTDGRIYAAWLDERNVHTPKPSTKADGHHMESNRDLYLSYSTDGGRTFSANRKVASEACPCCKTALTISADGTLYAGWRQVLPGSFRHIAVASSTDGGTNFSKPAIVSDDHWVLQGCPVSGPSLSVDRASGSLKVVWYAAGEGNAPGIYFAESKDKGHSFTPRQLLSQETVRGTPALAAGQNNAIAVWQAADTAETKMRQLGNAGSALSVAANAELPAGIFANEKLFVAYIGKEKEKRSIWLIRAE

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
96 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
97 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
100 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
102 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
103 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
104 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
105 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
106 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
107 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
108 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
109 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.1
Rhizosphere 97.9
Stem 0
Stem Tuber 0
Unclassified 22.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100009435 3300005618 Bacteria 8052
2 MBSR1b_contig_13143874 2162886012 Bacteria 2138
3 MBSR1b_contig_13704949 2162886012 Unclassified 1833
4 MBSR1b_contig_8776401 2162886012 Unclassified 1833
5 CNAas_1000643 3300000532 Bacteria 3364
6 JGI25406J46586_10002095 3300003203 Bacteria 9426
7 Ga0065712_10000122 3300005290 Bacteria 92508
8 Ga0065715_10002897 3300005293 Bacteria 7159
9 Ga0065715_10090376 3300005293 Bacteria 7124
10 Ga0070670_100000331 3300005331 Bacteria 39667
11 Ga0070682_100000765 3300005337 Bacteria 19038
12 Ga0070682_100157121 3300005337 Bacteria 1567
13 Ga0070689_100000147 3300005340 Bacteria 40915
14 Ga0070692_10067661 3300005345 Bacteria 1896
15 Ga0070675_100081714 3300005354 Bacteria 2695
16 Ga0070674_100111821 3300005356 Bacteria 2007
17 Ga0070659_100014266 3300005366 Bacteria 5932
18 Ga0070700_100000065 3300005441 Bacteria 76224
19 Ga0070700_100050897 3300005441 Bacteria 2576
20 Ga0070694_100003454 3300005444 Bacteria 9468
21 Ga0070662_100055073 3300005457 Unclassified 2885
22 Ga0070681_10092440 3300005458 Unclassified 2974
23 Ga0070681_10182816 3300005458 Unclassified 2018
24 Ga0070706_100000661 3300005467 Bacteria 39338
25 Ga0070698_100000826 3300005471 Bacteria 33892
26 Ga0070699_100000632 3300005518 Bacteria 33010
27 Ga0070699_100003249 3300005518 Bacteria 14373
28 Ga0070679_100081670 3300005530 Unclassified 3221
29 Ga0070672_100132729 3300005543 Bacteria 2048
30 Ga0070695_100014223 3300005545 Bacteria 4796
31 Ga0070695_100016319 3300005545 Bacteria 4493
32 Ga0070696_100132850 3300005546 Bacteria 1813
33 Ga0070693_100004271 3300005547 Bacteria 6743
34 Ga0070693_100021026 3300005547 Unclassified 3451
35 Ga0070693_100033999 3300005547 Bacteria 2818
36 Ga0070704_100115645 3300005549 Unclassified 2050
37 Ga0070664_100236711 3300005564 Bacteria 1638
38 Ga0070702_100134798 3300005615 Bacteria 1565
39 Ga0068859_100022188 3300005617 Bacteria 6364
40 Ga0068859_100172796 3300005617 Unclassified 2242
41 Ga0068859_100202399 3300005617 Bacteria 2070
42 Ga0068864_100007629 3300005618 Bacteria 8910
43 Ga0068870_10004608 3300005840 Bacteria 5947
44 Ga0068863_100098444 3300005841 Bacteria 2778
45 Ga0068858_100099212 3300005842 Bacteria 2715
46 Ga0068860_100065761 3300005843 Unclassified 3443
47 Ga0081539_10001231 3300005985 Bacteria 45721
48 Ga0081539_10001477 3300005985 Bacteria 39895
49 Ga0070716_100054996 3300006173 Bacteria 2276
50 Ga0097621_100045637 3300006237 Unclassified 3540
51 Ga0075431_100060898 3300006847 Bacteria 3895
52 Ga0075431_100082002 3300006847 Unclassified 3329
53 Ga0075433_10128748 3300006852 Bacteria 2249
54 Ga0075434_100076499 3300006871 Bacteria 3342
55 Ga0075429_100100676 3300006880 Bacteria 2522
56 Ga0097620_100022188 3300006931 Bacteria 6364
57 Ga0097620_100172782 3300006931 Unclassified 2242
58 Ga0097620_100202424 3300006931 Bacteria 2070
59 Ga0075435_100010896 3300007076 Bacteria 6661
60 Ga0105240_10039503 3300009093 Bacteria 6041
61 Ga0111539_10007086 3300009094 Bacteria 14369
62 Ga0111539_10156919 3300009094 Bacteria 2663
63 Ga0105247_10000669 3300009101 Bacteria 27007
64 Ga0114129_10024898 3300009147 Bacteria 8486
65 Ga0114129_10092079 3300009147 Unclassified 4200
66 Ga0105243_10004495 3300009148 Bacteria 11021
67 Ga0105241_10104694 3300009174 Bacteria 2255
68 Ga0105241_10169414 3300009174 Bacteria 1802
69 Ga0105248_10001010 3300009177 Bacteria 31107
70 Ga0105248_10319974 3300009177 Bacteria 1747
71 Ga0105237_10001269 3300009545 Bacteria 33646
72 Ga0105237_10287894 3300009545 Bacteria 1646
73 Ga0105238_10007482 3300009551 Bacteria 10943
74 Ga0105249_10025884 3300009553 Bacteria 5285
75 Ga0105239_10234530 3300010375 Unclassified 2059
76 Ga0105239_10374384 3300010375 Unclassified 1610
77 Ga0157373_10004325 3300013100 Bacteria 10691
78 Ga0163162_10081711 3300013306 Bacteria 3302
79 Ga0157375_10049902 3300013308 Bacteria 4102
80 Ga0163163_10007227 3300014325 Bacteria 9786
81 Ga0163163_10016111 3300014325 Bacteria 6935
82 Ga0157379_10206917 3300014968 Unclassified 1775
83 Ga0163161_10026592 3300017792 Bacteria 4098
84 Ga0207653_10013585 3300025885 Bacteria 2550
85 Ga0207710_10000436 3300025900 Bacteria 27277
86 Ga0207647_10007153 3300025904 Bacteria 8093
87 Ga0207643_10002503 3300025908 Bacteria 9929
88 Ga0207643_10011003 3300025908 Bacteria 4883
89 Ga0207684_10000085 3300025910 Bacteria 175922
90 Ga0207684_10148168 3300025910 Bacteria 2019
91 Ga0207671_10029529 3300025914 Bacteria 4094
92 Ga0207652_10102767 3300025921 Unclassified 2526
93 Ga0207694_10001929 3300025924 Bacteria 17169
94 Ga0207650_10000011 3300025925 Bacteria 450115
95 Ga0207650_10029953 3300025925 Unclassified 3916
96 Ga0207650_10047383 3300025925 Bacteria 3167
97 Ga0207709_10008042 3300025935 Bacteria 5841
98 Ga0207670_10004214 3300025936 Bacteria 7712
99 Ga0207691_10111655 3300025940 Unclassified 2430
100 Ga0207711_10003738 3300025941 Bacteria 13121
101 Ga0207689_10191270 3300025942 Bacteria 1688
102 Ga0207679_10038692 3300025945 Bacteria 3400
103 Ga0207679_10068555 3300025945 Unclassified 2665
104 Ga0207651_10251297 3300025960 Bacteria 1447
105 Ga0207712_10001295 3300025961 Bacteria 17155
106 Ga0207703_10045258 3300026035 Unclassified 3540
107 Ga0207639_10050519 3300026041 Bacteria 3158
108 Ga0207639_10073682 3300026041 Unclassified 2678
109 Ga0207708_10000091 3300026075 Bacteria 71484
110 Ga0207641_10094736 3300026088 Bacteria 2619
111 Ga0207676_10324933 3300026095 Bacteria 1414
112 Ga0207674_10033190 3300026116 Bacteria 5405
113 Ga0207674_10057907 3300026116 Unclassified 3928
114 Ga0207674_10145238 3300026116 Bacteria 2331
115 Ga0207675_100072027 3300026118 Bacteria 3231
116 Ga0207428_10007390 3300027907 Bacteria 10019
117 Ga0268264_10065926 3300028381 Unclassified 3052
118 Ga0268264_10214683 3300028381 Bacteria 1768
119 Ga0307408_100012120 3300031548 Bacteria 5706
120 Ga0307413_10090923 3300031824 Unclassified 1987
121 Ga0307406_10010372 3300031901 Bacteria 5252
122 Ga0307412_10005426 3300031911 Bacteria 7155
123 Ga0307416_100210159 3300032002 Unclassified 1855
124 Ga0307414_10008310 3300032004 Bacteria 5878
125 Ga0307411_10017303 3300032005 Unclassified 4104
126 Ga0307415_100112317 3300032126 Unclassified 2024
127 Ga0395898_0321456 3300037466 Bacteria 1476
128 Ga0242422_00592 3300038699 Bacteria 2356
129 Ga0439458_0007902 3300042157 Bacteria 2366
130 Ga0495668_0000102 3300046616 Bacteria 137192
131 Ga0496108_0094639 3300048911 Bacteria 2543
132 Ga0496112_0158144 3300048915 Bacteria 2233
133 Ga0496112_0239199 3300048915 Bacteria 1769
134 Ga0501038_0007478 3300049574 Bacteria 10078
135 Ga0501217_002930 3300049661 Unclassified 3414
136 Ga0501223_002191 3300049663 Unclassified 4383
137 Ga0501224_008589 3300049664 Unclassified 1490
138 Ga0501227_001574 3300049665 Bacteria 5084
139 Ga0501225_0002220 3300049705 Bacteria 6003
140 nmdc:mga09592_153086_c1 3300050508 Bacteria 1990
141 nmdc:mga0n895_75037_c1 3300050512 Bacteria 3361
142 nmdc:mga0a205_90307_c1 3300050515 Bacteria 2960
143 Ga0530510_0010787 3300061734 Bacteria 6411
144 Ga0068864_100009435
145 MBSR1b_contig_13143874
146 MBSR1b_contig_13704949
147 MBSR1b_contig_8776401
148 CNAas_1000643
149 JGI25406J46586_10002095
150 Ga0065712_10000122
151 Ga0065715_10002897
152 Ga0065715_10090376
153 Ga0070670_100000331
154 Ga0070682_100000765
155 Ga0070682_100157121
156 Ga0070689_100000147
157 Ga0070692_10067661
158 Ga0070675_100081714
159 Ga0070674_100111821
160 Ga0070659_100014266
161 Ga0070700_100000065
162 Ga0070700_100050897
163 Ga0070694_100003454
164 Ga0070662_100055073
165 Ga0070681_10092440
166 Ga0070681_10182816
167 Ga0070706_100000661
168 Ga0070698_100000826
169 Ga0070699_100000632
170 Ga0070699_100003249
171 Ga0070679_100081670
172 Ga0070672_100132729
173 Ga0070695_100014223
174 Ga0070695_100016319
175 Ga0070696_100132850
176 Ga0070693_100004271
177 Ga0070693_100021026
178 Ga0070693_100033999
179 Ga0070704_100115645
180 Ga0070664_100236711
181 Ga0070702_100134798
182 Ga0068859_100022188
183 Ga0068859_100172796
184 Ga0068859_100202399
185 Ga0068864_100007629
186 Ga0068870_10004608
187 Ga0068863_100098444
188 Ga0068858_100099212
189 Ga0068860_100065761
190 Ga0081539_10001231
191 Ga0081539_10001477
192 Ga0070716_100054996
193 Ga0097621_100045637
194 Ga0075431_100060898
195 Ga0075431_100082002
196 Ga0075433_10128748
197 Ga0075434_100076499
198 Ga0075429_100100676
199 Ga0097620_100022188
200 Ga0097620_100172782
201 Ga0097620_100202424
202 Ga0075435_100010896
203 Ga0105240_10039503
204 Ga0111539_10007086
205 Ga0111539_10156919
206 Ga0105247_10000669
207 Ga0114129_10024898
208 Ga0114129_10092079
209 Ga0105243_10004495
210 Ga0105241_10104694
211 Ga0105241_10169414
212 Ga0105248_10001010
213 Ga0105248_10319974
214 Ga0105237_10001269
215 Ga0105237_10287894
216 Ga0105238_10007482
217 Ga0105249_10025884
218 Ga0105239_10234530
219 Ga0105239_10374384
220 Ga0157373_10004325
221 Ga0163162_10081711
222 Ga0157375_10049902
223 Ga0163163_10007227
224 Ga0163163_10016111
225 Ga0157379_10206917
226 Ga0163161_10026592
227 Ga0207653_10013585
228 Ga0207710_10000436
229 Ga0207647_10007153
230 Ga0207643_10002503
231 Ga0207643_10011003
232 Ga0207684_10000085
233 Ga0207684_10148168
234 Ga0207671_10029529
235 Ga0207652_10102767
236 Ga0207694_10001929
237 Ga0207650_10000011
238 Ga0207650_10029953
239 Ga0207650_10047383
240 Ga0207709_10008042
241 Ga0207670_10004214
242 Ga0207691_10111655
243 Ga0207711_10003738
244 Ga0207689_10191270
245 Ga0207679_10038692
246 Ga0207679_10068555
247 Ga0207651_10251297
248 Ga0207712_10001295
249 Ga0207703_10045258
250 Ga0207639_10050519
251 Ga0207639_10073682
252 Ga0207708_10000091
253 Ga0207641_10094736
254 Ga0207676_10324933
255 Ga0207674_10033190
256 Ga0207674_10057907
257 Ga0207674_10145238
258 Ga0207675_100072027
259 Ga0207428_10007390
260 Ga0268264_10065926
261 Ga0268264_10214683
262 Ga0307408_100012120
263 Ga0307413_10090923
264 Ga0307406_10010372
265 Ga0307412_10005426
266 Ga0307416_100210159
267 Ga0307414_10008310
268 Ga0307411_10017303
269 Ga0307415_100112317
270 Ga0395898_0321456
271 Ga0242422_00592
272 Ga0439458_0007902
273 Ga0495668_0000102
274 Ga0496108_0094639
275 Ga0496112_0158144
276 Ga0496112_0239199
277 Ga0501038_0007478
278 Ga0501217_002930
279 Ga0501223_002191
280 Ga0501224_008589
281 Ga0501227_001574
282 Ga0501225_0002220
283 nmdc:mga09592_153086_c1
284 nmdc:mga0n895_75037_c1
285 nmdc:mga0a205_90307_c1
286 Ga0530510_0010787

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rg2-assembly1.cif.gz_A photorhabdus laumondii lectin pll2 in complex with 3-o-methyl-d-glucose 0.7885 45 417
6rfz-assembly1.cif.gz_A photorhabdus laumondii lectin pll2 in complex with d-glucose 0.778 45 417
6fhx-assembly1.cif.gz_A photorhabdus asymbiotica lectin (phl) in complex with synthetic c-fucoside 0.7483 45 415
5mxh-assembly1.cif.gz_A photorhabdus asymbiotica lectin (phl) in complex with d-galactose 0.7463 45 415
7b7c-assembly1.cif.gz_A room temperature x-ray structure of perdeuterated pll lectin in complex with l-fucose 0.7414 45 415
ID Description Score Start End Superfamily
af_Q9TZ27_64_133_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.7686 348 383 2.40.50.100
af_Q9TZ22_50_127_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.7551 348 384 2.40.50.100
af_Q9GR36_50_121_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.7462 342 383 2.40.50.100
af_K7LJY2_327_523_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.7314 297 402 2.40.128.630
af_Q4D9Y1_1_92_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.7287 385 417 3.30.450.30
ID Description Score Start End GO Terms
AF-A0A2V8RQU6-F1-model_v4 Exo-alpha-sialidase 0.9315 19 417
AF-A0A7Y4TT38-F1-model_v4 Exo-alpha-sialidase 0.9272 38 417
AF-A0A2V8SLX1-F1-model_v4 Exo-alpha-sialidase 0.9133 37 417
AF-A0A2V8RQU6-F1-model_v4 Exo-alpha-sialidase 0.8903 19 417
AF-A0A7Y4TT38-F1-model_v4 Exo-alpha-sialidase 0.8778 38 417

Map