F188174

General Info

Members Datasets Scaffolds Average Seq Length
143 93 143 280

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100000002|Ga0068855_100000002101
Length 316
Sequence MAKKAELLEAAKKLGLELSEKNTIKEIEEAIQATGTTVAAEELAVLEDTPVAKAGKRSAKAISGDTTPTDSEAPAAKKGPRPVTRPLIERRGKNYRKVAELVDATKFYNLADAIELASKTSPSKFDASVEVHVRLNVDPRQADQNIRATVSLPNGTGKTVRVAVFTPEADHKAAKAAGADVVGDETFLAQLDKEEINFDILIATPQFMPRLGKYARLLGPRGLMPNPKSGSVATDVAKAVTEAKAGKVEYRVDKQAIVHLSIGKVSFGAAKLAENAKSFFDSLTSQKPTSIKGSYVKSISVSTTQGPGIKVENFIN

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
11 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
26 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
44 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
45 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
46 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
47 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
48 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
49 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
50 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
51 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
52 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
53 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
54 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
55 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
56 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
57 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
58 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
59 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
60 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
61 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
62 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
63 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
64 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
65 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
66 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
67 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
68 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
69 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
73 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
74 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
75 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
76 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
77 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
78 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
79 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
80 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
81 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
82 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
83 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
84 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
85 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
86 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
87 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
88 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
89 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
90 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
91 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
92 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
93 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.37
Nodule 0
Rhizoplane 0.7
Rhizosphere 65.73
Stem 0
Stem Tuber 0
Unclassified 4.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10010401 3300003316 Bacteria 137135
2 rootH2_10004265 3300003320 Bacteria 78343
3 rootH1_10018225 3300003323 Bacteria 53223
4 rootH1_10207114 3300003323 Bacteria 1936
5 Ga0070670_100337085 3300005331 Bacteria 1323
6 Ga0070660_100000848 3300005339 Bacteria 20334
7 Ga0070661_100147280 3300005344 Unclassified 1778
8 Ga0070681_10056014 3300005458 Bacteria 3924
9 Ga0070704_100052581 3300005549 Bacteria 2874
10 Ga0068855_100000002 3300005563 Bacteria 616881
11 Ga0068855_100000107 3300005563 Bacteria 103580
12 Ga0068855_100023622 3300005563 Bacteria 7364
13 Ga0070664_100164789 3300005564 Bacteria 1963
14 Ga0068854_100224706 3300005578 Bacteria 1487
15 Ga0068852_100000001 3300005616 Bacteria 716526
16 Ga0068852_100166197 3300005616 Bacteria 2064
17 Ga0081455_10000001 3300005937 Bacteria 603871
18 Ga0075365_10000028 3300006038 Bacteria 58142
19 Ga0075365_10000045 3300006038 Bacteria 40602
20 Ga0075365_10000936 3300006038 Bacteria 12354
21 Ga0075365_10000953 3300006038 Bacteria 12275
22 Ga0075368_10000415 3300006042 Bacteria 12543
23 Ga0075363_100003445 3300006048 Bacteria 6724
24 Ga0075364_10000046 3300006051 Bacteria 43174
25 Ga0075364_10003156 3300006051 Bacteria 9325
26 Ga0075364_10030292 3300006051 Unclassified 3473
27 Ga0075367_10000327 3300006178 Bacteria 16833
28 Ga0097621_100000003 3300006237 Bacteria 164830
29 Ga0068871_100000017 3300006358 Bacteria 91144
30 Ga0105240_10000004 3300009093 Bacteria 708156
31 Ga0105240_10003473 3300009093 Bacteria 24451
32 Ga0105240_10003896 3300009093 Bacteria 23046
33 Ga0105241_10008632 3300009174 Bacteria 7489
34 Ga0105237_10000001 3300009545 Bacteria 1009213
35 Ga0105237_10000002 3300009545 Bacteria 702357
36 Ga0105237_10095290 3300009545 Bacteria 2965
37 Ga0105238_10001853 3300009551 Bacteria 21198
38 Ga0105032_100001 3300009979 Bacteria 472394
39 Ga0105032_100065 3300009979 Bacteria 11981
40 Ga0105032_100605 3300009979 Unclassified 3509
41 Ga0105028_101581 3300009993 Bacteria 2392
42 Ga0105239_10061240 3300010375 Bacteria 4130
43 Ga0157371_10016539 3300013102 Bacteria 5501
44 Ga0157371_10065480 3300013102 Bacteria 2574
45 Ga0157370_10014701 3300013104 Bacteria 7995
46 Ga0157369_10000009 3300013105 Bacteria 303674
47 Ga0157369_10000469 3300013105 Bacteria 53574
48 Ga0157369_10038470 3300013105 Bacteria 5230
49 Ga0157369_10126130 3300013105 Bacteria 2713
50 Ga0157374_10164616 3300013296 Bacteria 2161
51 Ga0157372_10000002 3300013307 Bacteria 687862
52 Ga0157372_10000008 3300013307 Bacteria 305449
53 Ga0157372_10008204 3300013307 Bacteria 11100
54 Ga0157372_10125569 3300013307 Bacteria 2950
55 Ga0157377_10012640 3300014745 Bacteria 4249
56 Ga0207695_10000009 3300025913 Bacteria 1034276
57 Ga0207695_10003269 3300025913 Bacteria 23038
58 Ga0207695_10006895 3300025913 Bacteria 14613
59 Ga0207671_10000003 3300025914 Bacteria 1065461
60 Ga0207671_10000008 3300025914 Bacteria 798229
61 Ga0207671_10072385 3300025914 Bacteria 2572
62 Ga0207657_10043300 3300025919 Bacteria 3966
63 Ga0207694_10023010 3300025924 Bacteria 4729
64 Ga0207679_10137593 3300025945 Bacteria 1969
65 Ga0207667_10000005 3300025949 Bacteria 715503
66 Ga0207667_10000128 3300025949 Bacteria 116173
67 Ga0207667_10048830 3300025949 Bacteria 4473
68 Ga0207640_10007698 3300025981 Bacteria 5954
69 Ga0207674_10017172 3300026116 Bacteria 7899
70 Ga0207674_10072349 3300026116 Bacteria 3464
71 Ga0207698_10000001 3300026142 Bacteria 625389
72 Ga0207698_10585414 3300026142 Bacteria 1098
73 Ga0209813_10000197 3300027866 Bacteria 18622
74 Ga0209974_10023331 3300027876 Bacteria 2047
75 Ga0314311_1060244 3300030733 Bacteria 4775
76 Ga0316179_1000887 3300030734 Bacteria 22050
77 Ga0316178_1157202 3300030735 Unclassified 1645
78 Ga0316180_1024638 3300030736 Bacteria 2106
79 Ga0316183_1020987 3300030742 Bacteria 11927
80 Ga0316183_1033544 3300030742 Bacteria 8423
81 Ga0316183_1131937 3300030742 Bacteria 7071
82 Ga0316183_1162140 3300030742 Bacteria 1850
83 Ga0316181_1063761 3300030744 Bacteria 284591
84 Ga0316182_1033270 3300030745 Bacteria 11693
85 Ga0316182_1071002 3300030745 Bacteria 6065
86 Ga0316182_1366652 3300030745 Bacteria 24336
87 Ga0316182_1395767 3300030745 Bacteria 4569
88 Ga0307516_10057516 3300031730 Bacteria 3788
89 Ga0307406_10000001 3300031901 Bacteria 638191
90 Ga0307406_10001410 3300031901 Bacteria 13351
91 Ga0395905_0002235 3300037471 Bacteria 21825
92 Ga0395901_0038117 3300038443 Bacteria 4972
93 Ga0439461_0000647 3300041410 Bacteria 5019
94 Ga0439432_038909 3300042006 Bacteria 1513
95 Ga0450903_002774 3300042138 Bacteria 3087
96 Ga0450906_002406 3300042145 Bacteria 4094
97 Ga0439446_0002905 3300042156 Bacteria 4182
98 Ga0439434_0002308 3300042435 Bacteria 5544
99 Ga0450918_004540 3300042531 Bacteria 2526
100 Ga0466965_0003110 3300044683 Bacteria 7235
101 Ga0495638_0000070 3300046460 Bacteria 166954
102 Ga0495638_0000189 3300046460 Bacteria 93205
103 Ga0495597_0012995 3300046542 Bacteria 3998
104 Ga0495660_0000090 3300046810 Bacteria 98309
105 Ga0496115_0000007 3300048918 Bacteria 244991
106 Ga0496124_0029993 3300048927 Bacteria 4836
107 Ga0501034_0000090 3300049571 Bacteria 165117
108 Ga0501034_0007677 3300049571 Bacteria 11480
109 Ga0501034_0045553 3300049571 Bacteria 4432
110 Ga0501037_0000001 3300049573 Bacteria 753276
111 Ga0501043_0314482 3300049579 Bacteria 1195
112 Ga0501080_0510080 3300049742 Bacteria 1074
113 nmdc:mga00v17_10783_c1 3300050491 Bacteria 5005
114 nmdc:mga00v17_2567_c1 3300050491 Bacteria 9325
115 nmdc:mga00v17_30_c1 3300050491 Bacteria 88199
116 nmdc:mga0yw44_12_c1 3300050492 Bacteria 128020
117 nmdc:mga0yw44_1_c1 3300050492 Bacteria 702221
118 nmdc:mga0yw44_32_c1 3300050492 Bacteria 50887
119 nmdc:mga0yw44_41791_c1 3300050492 Bacteria 2731
120 nmdc:mga0yw44_45_c1 3300050492 Bacteria 41778
121 nmdc:mga0yw44_6_c1 3300050492 Bacteria 272478
122 nmdc:mga04h51_159_c1 3300050495 Bacteria 19324
123 nmdc:mga07m45_27450_c1 3300050496 Bacteria 3136
124 Ga0500643_003058 3300053087 Bacteria 8243
125 Ga0500646_0000003 3300053090 Bacteria 144737
126 Ga0500646_0004890 3300053090 Bacteria 3396
127 Ga0500583_0000300 3300053092 Bacteria 17148
128 Ga0500651_0000001 3300053093 Bacteria 529808
129 Ga0500651_0000192 3300053093 Bacteria 39055
130 Ga0500641_0000001 3300053096 Bacteria 1115973
131 Ga0500650_0012029 3300053098 Bacteria 3589
132 Ga0500562_000001 3300053108 Bacteria 1178987
133 Ga0500569_000013 3300053109 Bacteria 50700
134 Ga0500594_0000004 3300053118 Bacteria 174508
135 Ga0500652_000001 3300053131 Bacteria 946868
136 Ga0500655_000401 3300053133 Bacteria 9181
137 Ga0500568_0007798 3300053139 Bacteria 5215
138 Ga0500577_0000147 3300053142 Bacteria 17244
139 Ga0500577_0022737 3300053142 Bacteria 2084
140 Ga0500588_0000062 3300053146 Bacteria 17047
141 Ga0500616_0000012 3300053153 Bacteria 681798
142 Ga0500570_006410 3300053724 Bacteria 6394
143 Ga0500613_001105 3300053738 Bacteria 1772

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10207114 rootH1_102071142 245
2 3300009093 Ga0105240_10003473 Ga0105240_100034734 257
3 3300025913 Ga0207695_10006895 Ga0207695_100068953 257
4 3300046460 Ga0495638_0000070 Ga0495638_0000070_20713_21651 257
5 3300009979 Ga0105032_100605 Ga0105032_1006055 258
6 3300050496 nmdc:mga07m45_27450_c1 nmdc:mga07m45_27450_c1_1881_2855 258
7 3300053724 Ga0500570_006410 Ga0500570_006410_2497_3474 258
8 3300009545 Ga0105237_10095290 Ga0105237_100952903 260
9 3300025914 Ga0207671_10072385 Ga0207671_100723852 260
10 3300049573 Ga0501037_0000001 Ga0501037_0000001_408719_409699 260
11 3300053142 Ga0500577_0022737 Ga0500577_0022737_967_2016 260
12 3300006038 Ga0075365_10000028 Ga0075365_1000002863 261
13 3300026116 Ga0207674_10017172 Ga0207674_100171727 261
14 3300050492 nmdc:mga0yw44_12_c1 nmdc:mga0yw44_12_c1_11833_12813 261
15 3300050492 nmdc:mga0yw44_1_c1 nmdc:mga0yw44_1_c1_488879_489862 261
16 3300006051 Ga0075364_10030292 Ga0075364_100302924 264
17 3300050491 nmdc:mga00v17_10783_c1 nmdc:mga00v17_10783_c1_3918_4871 264
18 3300046810 Ga0495660_0000090 Ga0495660_0000090_96541_97512 266
19 3300049579 Ga0501043_0314482 Ga0501043_0314482_22_1002 266
20 3300005937 Ga0081455_10000001 Ga0081455_1000000178 267
21 3300013102 Ga0157371_10016539 Ga0157371_100165393 267
22 3300053092 Ga0500583_0000300 Ga0500583_0000300_2082_3053 267
23 3300053096 Ga0500641_0000001 Ga0500641_0000001_286997_287968 267
24 3300053098 Ga0500650_0012029 Ga0500650_0012029_2184_3155 267
25 3300053131 Ga0500652_000001 Ga0500652_000001_74503_75474 267
26 3300006038 Ga0075365_10000936 Ga0075365_100009367 268
27 3300006051 Ga0075364_10003156 Ga0075364_100031564 268
28 3300013102 Ga0157371_10065480 Ga0157371_100654803 268
29 3300013105 Ga0157369_10000469 Ga0157369_1000046964 268
30 3300050491 nmdc:mga00v17_2567_c1 nmdc:mga00v17_2567_c1_6854_7789 268
31 3300050492 nmdc:mga0yw44_41791_c1 nmdc:mga0yw44_41791_c1_1147_2121 268
32 3300050492 nmdc:mga0yw44_45_c1 nmdc:mga0yw44_45_c1_19884_20819 268
33 3300053090 Ga0500646_0000003 Ga0500646_0000003_55868_56839 268
34 3300005344 Ga0070661_100147280 Ga0070661_1001472802 269
35 3300005458 Ga0070681_10056014 Ga0070681_100560142 269
36 3300005564 Ga0070664_100164789 Ga0070664_1001647893 269
37 3300013307 Ga0157372_10008204 Ga0157372_100082046 269
38 3300025945 Ga0207679_10137593 Ga0207679_101375933 269
39 3300042435 Ga0439434_0002308 Ga0439434_0002308_3959_4996 269
40 3300044683 Ga0466965_0003110 Ga0466965_0003110_5046_6014 269
41 3300053093 Ga0500651_0000192 Ga0500651_0000192_6896_7846 269
42 3300053738 Ga0500613_001105 Ga0500613_001105_769_1758 269
43 3300030735 Ga0316178_1157202 Ga0316178_11572022 270
44 3300053142 Ga0500577_0000147 Ga0500577_0000147_12448_13398 270
45 3300013105 Ga0157369_10126130 Ga0157369_101261304 271
46 3300014745 Ga0157377_10012640 Ga0157377_100126405 271
47 3300049571 Ga0501034_0000090 Ga0501034_0000090_77457_78437 271
48 3300053087 Ga0500643_003058 Ga0500643_003058_4424_5401 271
49 3300006038 Ga0075365_10000953 Ga0075365_100009536 272
50 3300006042 Ga0075368_10000415 Ga0075368_1000041510 272
51 3300006048 Ga0075363_100003445 Ga0075363_1000034456 272
52 3300006051 Ga0075364_10000046 Ga0075364_1000004625 272
53 3300006178 Ga0075367_10000327 Ga0075367_100003275 272
54 3300027866 Ga0209813_10000197 Ga0209813_100001978 272
55 3300042138 Ga0450903_002774 Ga0450903_002774_440_1414 272
56 3300050491 nmdc:mga00v17_30_c1 nmdc:mga00v17_30_c1_43303_44295 272
57 3300050492 nmdc:mga0yw44_6_c1 nmdc:mga0yw44_6_c1_250950_251942 272
58 3300050495 nmdc:mga04h51_159_c1 nmdc:mga04h51_159_c1_14801_15793 272
59 3300053093 Ga0500651_0000001 Ga0500651_0000001_133393_134367 272
60 3300053118 Ga0500594_0000004 Ga0500594_0000004_79104_80078 272
61 3300013105 Ga0157369_10038470 Ga0157369_100384707 273
62 3300042006 Ga0439432_038909 Ga0439432_038909_431_1399 273
63 3300041410 Ga0439461_0000647 Ga0439461_0000647_472_1467 274
64 3300049571 Ga0501034_0007677 Ga0501034_0007677_2793_3830 274
65 3300006237 Ga0097621_100000003 Ga0097621_100000003153 275
66 3300006358 Ga0068871_100000017 Ga0068871_10000001786 275
67 3300013307 Ga0157372_10125569 Ga0157372_101255695 275
68 3300026142 Ga0207698_10585414 Ga0207698_105854141 275
69 3300042156 Ga0439446_0002905 Ga0439446_0002905_2151_3188 276
70 3300005549 Ga0070704_100052581 Ga0070704_1000525812 277
71 3300010375 Ga0105239_10061240 Ga0105239_100612406 277
72 3300038443 Ga0395901_0038117 Ga0395901_0038117_852_1826 277
73 3300005563 Ga0068855_100000107 Ga0068855_100000107109 278
74 3300009093 Ga0105240_10003896 Ga0105240_100038962 278
75 3300025913 Ga0207695_10003269 Ga0207695_1000326925 278
76 3300025949 Ga0207667_10000128 Ga0207667_1000012818 278
77 3300030742 Ga0316183_1162140 Ga0316183_11621401 278
78 3300030742 Ga0316183_1020987 Ga0316183_10209875 279
79 3300030744 Ga0316181_1063761 Ga0316181_1063761274 279
80 3300030745 Ga0316182_1033270 Ga0316182_10332705 279
81 3300042145 Ga0450906_002406 Ga0450906_002406_231_1205 279
82 3300006038 Ga0075365_10000045 Ga0075365_1000004545 280
83 3300030745 Ga0316182_1395767 Ga0316182_13957675 280
84 3300050492 nmdc:mga0yw44_32_c1 nmdc:mga0yw44_32_c1_42759_43733 280
85 3300003323 rootH1_10018225 rootH1_1001822523 281
86 3300009979 Ga0105032_100001 Ga0105032_10000175 281
87 3300030742 Ga0316183_1033544 Ga0316183_10335448 281
88 3300053153 Ga0500616_0000012 Ga0500616_0000012_567116_568093 281
89 3300030745 Ga0316182_1366652 Ga0316182_13666528 282
90 3300046460 Ga0495638_0000189 Ga0495638_0000189_67142_68116 282
91 3300046542 Ga0495597_0012995 Ga0495597_0012995_1495_2469 282
92 3300053108 Ga0500562_000001 Ga0500562_000001_377918_378859 282
93 3300053109 Ga0500569_000013 Ga0500569_000013_25090_26064 282
94 3300053146 Ga0500588_0000062 Ga0500588_0000062_11316_12290 282
95 3300048927 Ga0496124_0029993 Ga0496124_0029993_187_1197 283
96 3300005578 Ga0068854_100224706 Ga0068854_1002247061 284
97 3300005616 Ga0068852_100166197 Ga0068852_1001661972 284
98 3300053090 Ga0500646_0004890 Ga0500646_0004890_894_1883 284
99 3300005563 Ga0068855_100023622 Ga0068855_1000236222 286
100 3300013105 Ga0157369_10000009 Ga0157369_10000009144 286
101 3300025949 Ga0207667_10048830 Ga0207667_100488302 286
102 3300025981 Ga0207640_10007698 Ga0207640_100076984 286
103 3300048918 Ga0496115_0000007 Ga0496115_0000007_125036_126031 286
104 3300005331 Ga0070670_100337085 Ga0070670_1003370851 287
105 3300042531 Ga0450918_004540 Ga0450918_004540_1481_2449 287
106 3300049742 Ga0501080_0510080 Ga0501080_0510080_31_1002 287
107 3300049571 Ga0501034_0045553 Ga0501034_0045553_761_1735 288
108 3300003320 rootH2_10004265 rootH2_1000426537 289
109 3300005616 Ga0068852_100000001 Ga0068852_100000001639 289
110 3300009174 Ga0105241_10008632 Ga0105241_100086326 289
111 3300009545 Ga0105237_10000002 Ga0105237_10000002532 289
112 3300009551 Ga0105238_10001853 Ga0105238_100018535 289
113 3300009979 Ga0105032_100065 Ga0105032_10006512 289
114 3300025914 Ga0207671_10000008 Ga0207671_10000008637 289
115 3300025924 Ga0207694_10023010 Ga0207694_100230103 289
116 3300026116 Ga0207674_10072349 Ga0207674_100723493 289
117 3300026142 Ga0207698_10000001 Ga0207698_10000001590 289
118 3300005339 Ga0070660_100000848 Ga0070660_1000008489 290
119 3300009093 Ga0105240_10000004 Ga0105240_10000004416 290
120 3300009545 Ga0105237_10000001 Ga0105237_10000001848 290
121 3300009993 Ga0105028_101581 Ga0105028_1015813 290
122 3300013104 Ga0157370_10014701 Ga0157370_100147014 290
123 3300013307 Ga0157372_10000002 Ga0157372_10000002393 290
124 3300025913 Ga0207695_10000009 Ga0207695_10000009795 290
125 3300025914 Ga0207671_10000003 Ga0207671_10000003851 290
126 3300025919 Ga0207657_10043300 Ga0207657_100433002 290
127 3300030733 Ga0314311_1060244 Ga0314311_10602442 290
128 3300030734 Ga0316179_1000887 Ga0316179_100088726 290
129 3300030736 Ga0316180_1024638 Ga0316180_10246382 290
130 3300030742 Ga0316183_1131937 Ga0316183_11319373 290
131 3300030745 Ga0316182_1071002 Ga0316182_10710027 290
132 3300037471 Ga0395905_0002235 Ga0395905_0002235_5308_6207 290
133 3300027876 Ga0209974_10023331 Ga0209974_100233312 291
134 3300031901 Ga0307406_10001410 Ga0307406_100014108 292
135 3300053133 Ga0500655_000401 Ga0500655_000401_244_1260 292
136 3300031730 Ga0307516_10057516 Ga0307516_100575163 296
137 3300031901 Ga0307406_10000001 Ga0307406_1000000118 296
138 3300013307 Ga0157372_10000008 Ga0157372_10000008116 297
139 3300013296 Ga0157374_10164616 Ga0157374_101646162 298
140 3300053139 Ga0500568_0007798 Ga0500568_0007798_733_1758 302
141 3300005563 Ga0068855_100000002 Ga0068855_100000002101 308
142 3300025949 Ga0207667_10000005 Ga0207667_10000005211 308
143 3300003316 rootH1_10010401 rootH1_1001040199 309

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00687

Ribosomal_L1

Ribosomal protein L1p/L10e family

117

307

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vpl-assembly1.cif.gz_A the structure of the complex between the first domain of l1 protein from thermus thermophilus and mrna from methanococcus jannaschii 0.9375 84 305
4wpo-assembly1.cif.gz_AC crystal structure of the thermus thermophilus 70s ribosome in complex with elongation factor g in the pre-translocational state 0.9321 84 305
2ov7-assembly3.cif.gz_C the first domain of the ribosomal protein l1 from thermus thermophilus 0.9218 92 305
6wdj-assembly1.cif.gz_a cryo-em of elongating ribosome with ef-tu*gtp elucidates trna proofreading (non-cognate structure v-a1) 0.9209 84 305
4wpo-assembly1.cif.gz_AC crystal structure of the thermus thermophilus 70s ribosome in complex with elongation factor g in the pre-translocational state 0.9192 84 305
ID Description Score Start End Superfamily
af_Q60E59_194_280_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.95 153 239 3.40.50.790
af_Q60E59_194_280_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.9397 153 239 3.40.50.790
2wrrC01 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9237 96 305 3.30.190.20
af_Q8IBY1_171_256_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.9187 151 237 3.40.50.790
2vplC01 Special;Helix non-globular;Arc Repressor Mutant, subunit A;50S ribosomal protein L1; Chain A, Domain 1 0.9167 84 114 6.10.20.140
ID Description Score Start End GO Terms
AF-A0A7C1DJ35-F1-model_v4 Large ribosomal subunit protein uL1 (50S ribosomal protein L1) 0.8902 139 306 GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843
AF-A0A1R0H960-F1-model_v4 50S ribosomal protein L1 0.8796 121 254 GO:0005840
GO:1990904
AF-A0A7C1DJ35-F1-model_v4 Large ribosomal subunit protein uL1 (50S ribosomal protein L1) 0.84 139 306 GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843
AF-F0V938-F1-model_v4 Ribosomal protein L1, related 0.8322 117 305 GO:0005840
GO:1990904
AF-A0A1R0H960-F1-model_v4 50S ribosomal protein L1 0.8277 121 254 GO:0005840
GO:1990904

Feature Viewer

pLDDT pTM Quality
75.53 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map