F188163

General Info

Members Datasets Scaffolds Average Seq Length
143 110 143 331

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100031438|Ga0070665_1000314382
Length 353
Sequence VDRTGADGRIASAPVRPTLSVLIVAYDSRDDLTKTLPALLAELSDGDELIVVDNKPGDGSAELVRELAPTARIVEPGGNSGFAGGCNAGAAEASGDLLVILNPDAAPRPGFGEAIRRPWVEERGWDAWQALVTDGRGELVNSAGNPVHFTGIVWAGDHGRPLGETPASEVTAASGACLAISLESWRRLDGFPAEFFMYHEDVDLSVRLWSAGGAVGIEPSAVVAHAYEFGANADKWRWLERNRLAFLVRTYPGTLLLLLAPALLATELALXXXXAAGGWGGQKLRADLEFLRWLPRLLRERREVQARRTIPAGEFAARLTPDLDSELISPLVRSWPARMLLRGYWRLVRLLLR

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
56 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
57 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
58 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
59 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
60 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
61 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
62 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
63 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
64 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
65 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
66 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
67 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
68 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
69 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
70 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
71 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
72 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
73 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
74 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
75 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
76 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
77 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
78 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
79 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
80 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
81 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
82 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
83 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
97 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
98 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
99 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
100 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
101 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
102 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
106 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
107 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
108 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
109 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
110 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 7.69
Rhizosphere 85.31
Stem 0
Stem Tuber 0
Unclassified 6.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000158 3300001977 Bacteria 8696
2 JGI24740J21852_10000709 3300001979 Bacteria 14444
3 Ga0070683_100000336 3300005329 Bacteria 32282
4 Ga0070683_100000619 3300005329 Bacteria 25554
5 Ga0070683_100091794 3300005329 Bacteria 2852
6 Ga0070682_100248183 3300005337 Bacteria 1282
7 Ga0070668_100003873 3300005347 Bacteria 11045
8 Ga0070659_100107959 3300005366 Bacteria 2245
9 Ga0070667_100074383 3300005367 Bacteria 2898
10 Ga0070667_100359987 3300005367 Bacteria 1318
11 Ga0070711_100023993 3300005439 Bacteria 3974
12 Ga0070663_100005991 3300005455 Bacteria 7276
13 Ga0070706_100015187 3300005467 Bacteria 7111
14 Ga0070679_100008398 3300005530 Bacteria 9720
15 Ga0070684_100001455 3300005535 Bacteria 17079
16 Ga0070684_100137129 3300005535 Bacteria 2211
17 Ga0070665_100031438 3300005548 Bacteria 5344
18 Ga0070665_100249059 3300005548 Bacteria 1777
19 Ga0068857_100081918 3300005577 Bacteria 2882
20 Ga0068854_100000136 3300005578 Bacteria 51080
21 Ga0068851_10005831 3300005834 Bacteria 5611
22 Ga0068863_100024445 3300005841 Bacteria 5761
23 Ga0068858_100000091 3300005842 Bacteria 93802
24 Ga0068862_100001683 3300005844 Bacteria 20024
25 Ga0081455_10005387 3300005937 Bacteria 14047
26 Ga0081539_10000791 3300005985 Bacteria 61600
27 Ga0070712_100010232 3300006175 Bacteria 5914
28 Ga0075433_10000041 3300006852 Bacteria 52354
29 Ga0075433_10113491 3300006852 Bacteria 2404
30 Ga0105245_10014976 3300009098 Bacteria 6756
31 Ga0105247_10006073 3300009101 Bacteria 7506
32 Ga0114129_10345210 3300009147 Unclassified 1973
33 Ga0105242_10000398 3300009176 Bacteria 34481
34 Ga0105249_10031255 3300009553 Bacteria 4815
35 Ga0157371_10002993 3300013102 Bacteria 15687
36 Ga0157370_10015651 3300013104 Bacteria 7704
37 Ga0157378_10003512 3300013297 Bacteria 13902
38 Ga0157375_10001152 3300013308 Bacteria 22842
39 Ga0157380_10000132 3300014326 Bacteria 41696
40 Ga0157379_10058852 3300014968 Bacteria 3436
41 Ga0206353_11772243 3300020082 Bacteria 2832
42 Ga0207656_10000941 3300025321 Bacteria 9494
43 Ga0207710_10000195 3300025900 Bacteria 57216
44 Ga0207680_10091545 3300025903 Bacteria 1935
45 Ga0207693_10006565 3300025915 Bacteria 9624
46 Ga0207663_10100343 3300025916 Bacteria 1942
47 Ga0207660_10136575 3300025917 Bacteria 1871
48 Ga0207652_10000866 3300025921 Bacteria 28643
49 Ga0207652_10143208 3300025921 Bacteria 2138
50 Ga0207687_10002500 3300025927 Bacteria 12481
51 Ga0207686_10000322 3300025934 Bacteria 34436
52 Ga0207661_10000224 3300025944 Bacteria 36954
53 Ga0207661_10000262 3300025944 Bacteria 33960
54 Ga0207661_10008253 3300025944 Bacteria 7438
55 Ga0207661_10038056 3300025944 Bacteria 3768
56 Ga0207712_10002551 3300025961 Bacteria 11698
57 Ga0207668_10131981 3300025972 Bacteria 1908
58 Ga0207658_10000789 3300025986 Bacteria 26987
59 Ga0207658_10090474 3300025986 Bacteria 2372
60 Ga0207658_10239410 3300025986 Bacteria 1536
61 Ga0207703_10000152 3300026035 Bacteria 79658
62 Ga0207678_10019477 3300026067 Bacteria 5961
63 Ga0207641_10005436 3300026088 Bacteria 10874
64 Ga0268266_10000368 3300028379 Bacteria 69355
65 Ga0268266_10014316 3300028379 Bacteria 6821
66 Ga0268266_10122940 3300028379 Bacteria 2311
67 Ga0268265_10002694 3300028380 Bacteria 13159
68 Ga0268264_10051968 3300028381 Bacteria 3416
69 Ga0268264_10270707 3300028381 Bacteria 1587
70 Ga0466967_0104080 3300045976 Bacteria 2598
71 Ga0495662_0060803 3300046476 Unclassified 1824
72 Ga0495608_0000068 3300046511 Bacteria 79694
73 Ga0495628_0000891 3300046516 Bacteria 27515
74 Ga0495652_0000019 3300046529 Bacteria 190248
75 Ga0495640_0203914 3300046533 Bacteria 1252
76 Ga0495645_0065264 3300046543 Unclassified 2633
77 Ga0495656_0002145 3300046615 Bacteria 6519
78 Ga0495634_0000018 3300046642 Bacteria 121323
79 Ga0495625_0000696 3300046660 Bacteria 47763
80 Ga0495657_0000004 3300046675 Bacteria 266465
81 Ga0495674_0001564 3300047319 Bacteria 22423
82 Ga0495675_0000107 3300047444 Bacteria 59970
83 Ga0495602_0000533 3300048088 Bacteria 35335
84 Ga0496102_0341761 3300048905 Bacteria 1409
85 Ga0496104_0000004 3300048907 Bacteria 641830
86 Ga0496105_0000001 3300048908 Bacteria 1328178
87 Ga0496108_0000062 3300048911 Bacteria 122391
88 Ga0496108_0002109 3300048911 Bacteria 15927
89 Ga0496109_0000007 3300048912 Bacteria 247554
90 Ga0496109_0000129 3300048912 Bacteria 77469
91 Ga0496109_0001311 3300048912 Bacteria 20538
92 Ga0496109_0195106 3300048912 Bacteria 1903
93 Ga0496114_0000014 3300048917 Bacteria 297902
94 Ga0496115_0000125 3300048918 Bacteria 69936
95 Ga0496116_0001000 3300048919 Bacteria 34584
96 Ga0496117_0015123 3300048920 Bacteria 6604
97 Ga0496118_0000818 3300048921 Bacteria 49518
98 Ga0496118_0035130 3300048921 Bacteria 4076
99 Ga0496119_0001814 3300048922 Bacteria 24807
100 Ga0496119_0020278 3300048922 Bacteria 4855
101 Ga0496120_0004397 3300048923 Bacteria 11842
102 Ga0496121_0023701 3300048924 Bacteria 5899
103 Ga0496124_0291091 3300048927 Bacteria 1185
104 Ga0501031_0001338 3300049568 Bacteria 15170
105 Ga0501032_0002275 3300049569 Bacteria 15088
106 Ga0501033_0001098 3300049570 Bacteria 24521
107 Ga0501036_0002000 3300049572 Bacteria 15838
108 Ga0501037_0001794 3300049573 Bacteria 15597
109 Ga0501038_0002586 3300049574 Bacteria 16890
110 Ga0501039_0013503 3300049575 Bacteria 6246
111 Ga0501040_0006643 3300049576 Bacteria 7507
112 Ga0501042_0208781 3300049578 Bacteria 1408
113 Ga0501043_0001937 3300049579 Bacteria 17724
114 Ga0501046_0001377 3300049580 Bacteria 23392
115 Ga0501047_0002402 3300049581 Bacteria 17890
116 Ga0501047_0003002 3300049581 Bacteria 16018
117 Ga0501047_0185840 3300049581 Bacteria 1943
118 Ga0501048_0001866 3300049582 Bacteria 15992
119 Ga0501069_0050161 3300049585 Bacteria 2320
120 Ga0501070_0001425 3300049586 Bacteria 21419
121 Ga0501070_0009296 3300049586 Bacteria 8314
122 Ga0501070_0031626 3300049586 Bacteria 4434
123 Ga0501073_0008848 3300049589 Bacteria 7446
124 Ga0501074_0001505 3300049590 Bacteria 15719
125 Ga0501074_0023297 3300049590 Bacteria 4502
126 Ga0501079_0265642 3300049741 Bacteria 1341
127 Ga0501080_0022060 3300049742 Bacteria 5899
128 Ga0501080_0153654 3300049742 Bacteria 2126
129 Ga0501080_0408946 3300049742 Bacteria 1220
130 Ga0501083_0002442 3300049744 Bacteria 12716
131 Ga0501083_0002503 3300049744 Bacteria 12609
132 Ga0501083_0033618 3300049744 Bacteria 3510
133 Ga0501035_0001806 3300049822 Bacteria 21632
134 Ga0501044_0004212 3300049823 Bacteria 16157
135 Ga0501044_0071712 3300049823 Bacteria 3522
136 nmdc:mga05p37_175188_c1 3300050507 Unclassified 1906
137 nmdc:mga0a205_24_c2 3300050515 Bacteria 81894
138 nmdc:mga0a205_540_c1 3300050515 Bacteria 29856
139 Ga0495595_0000003 3300053084 Bacteria 266465
140 Ga0495619_0000025 3300053085 Bacteria 167905
141 Ga0495619_0000106 3300053085 Bacteria 62413
142 Ga0500595_018051 3300053119 Bacteria 2588
143 Ga0501084_0121648 3300054114 Bacteria 2195

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046511 Ga0495608_0000068 Ga0495608_0000068_50154_51179 309
2 3300046675 Ga0495657_0000004 Ga0495657_0000004_93903_94928 309
3 3300047444 Ga0495675_0000107 Ga0495675_0000107_47689_48714 309
4 3300053084 Ga0495595_0000003 Ga0495595_0000003_93903_94928 309
5 3300053085 Ga0495619_0000106 Ga0495619_0000106_11245_12270 309
6 3300025903 Ga0207680_10091545 Ga0207680_100915451 310
7 3300049581 Ga0501047_0002402 Ga0501047_0002402_4150_5175 313
8 3300005367 Ga0070667_100359987 Ga0070667_1003599871 314
9 3300005548 Ga0070665_100249059 Ga0070665_1002490592 314
10 3300025986 Ga0207658_10239410 Ga0207658_102394101 314
11 3300028379 Ga0268266_10000368 Ga0268266_1000036867 314
12 3300048927 Ga0496124_0291091 Ga0496124_0291091_87_1112 314
13 3300049568 Ga0501031_0001338 Ga0501031_0001338_13651_14676 314
14 3300049569 Ga0501032_0002275 Ga0501032_0002275_360_1385 314
15 3300049570 Ga0501033_0001098 Ga0501033_0001098_16458_17483 314
16 3300049572 Ga0501036_0002000 Ga0501036_0002000_14592_15617 314
17 3300049573 Ga0501037_0001794 Ga0501037_0001794_237_1262 314
18 3300049574 Ga0501038_0002586 Ga0501038_0002586_298_1323 314
19 3300049575 Ga0501039_0013503 Ga0501039_0013503_4687_5712 314
20 3300049576 Ga0501040_0006643 Ga0501040_0006643_6204_7229 314
21 3300049579 Ga0501043_0001937 Ga0501043_0001937_16467_17492 314
22 3300049580 Ga0501046_0001377 Ga0501046_0001377_7975_9000 314
23 3300049581 Ga0501047_0003002 Ga0501047_0003002_13356_14381 314
24 3300049582 Ga0501048_0001866 Ga0501048_0001866_14603_15628 314
25 3300049585 Ga0501069_0050161 Ga0501069_0050161_1024_2049 314
26 3300049586 Ga0501070_0001425 Ga0501070_0001425_13356_14381 314
27 3300049589 Ga0501073_0008848 Ga0501073_0008848_6102_7127 314
28 3300049590 Ga0501074_0001505 Ga0501074_0001505_14185_15210 314
29 3300049741 Ga0501079_0265642 Ga0501079_0265642_239_1264 314
30 3300049742 Ga0501080_0022060 Ga0501080_0022060_4479_5504 314
31 3300049744 Ga0501083_0002503 Ga0501083_0002503_370_1395 314
32 3300049822 Ga0501035_0001806 Ga0501035_0001806_13569_14594 314
33 3300049823 Ga0501044_0004212 Ga0501044_0004212_458_1483 314
34 3300054114 Ga0501084_0121648 Ga0501084_0121648_926_1951 314
35 3300005329 Ga0070683_100091794 Ga0070683_1000917943 315
36 3300005455 Ga0070663_100005991 Ga0070663_1000059913 315
37 3300005530 Ga0070679_100008398 Ga0070679_1000083982 315
38 3300025921 Ga0207652_10000866 Ga0207652_1000086619 315
39 3300025944 Ga0207661_10008253 Ga0207661_100082533 315
40 3300026067 Ga0207678_10019477 Ga0207678_100194772 315
41 3300005467 Ga0070706_100015187 Ga0070706_1000151873 316
42 3300009147 Ga0114129_10345210 Ga0114129_103452102 316
43 3300050507 nmdc:mga05p37_175188_c1 nmdc:mga05p37_175188_c1_115_1146 316
44 3300020082 Ga0206353_11772243 Ga0206353_117722434 317
45 3300025921 Ga0207652_10143208 Ga0207652_101432082 317
46 3300048919 Ga0496116_0001000 Ga0496116_0001000_33484_34512 318
47 3300048921 Ga0496118_0035130 Ga0496118_0035130_2991_4019 318
48 3300048922 Ga0496119_0001814 Ga0496119_0001814_23202_24230 318
49 3300048923 Ga0496120_0004397 Ga0496120_0004397_10231_11259 318
50 3300006852 Ga0075433_10000041 Ga0075433_100000412 319
51 3300050515 nmdc:mga0a205_24_c2 nmdc:mga0a205_24_c2_19940_20968 319
52 3300028379 Ga0268266_10122940 Ga0268266_101229402 320
53 3300053119 Ga0500595_018051 Ga0500595_018051_361_1389 320
54 3300009176 Ga0105242_10000398 Ga0105242_1000039827 321
55 3300025934 Ga0207686_10000322 Ga0207686_100003225 321
56 3300048924 Ga0496121_0023701 Ga0496121_0023701_91_1119 321
57 3300046543 Ga0495645_0065264 Ga0495645_0065264_252_1271 323
58 3300005439 Ga0070711_100023993 Ga0070711_1000239932 326
59 3300025916 Ga0207663_10100343 Ga0207663_101003432 326
60 3300005366 Ga0070659_100107959 Ga0070659_1001079591 328
61 3300013104 Ga0157370_10015651 Ga0157370_100156517 328
62 3300025917 Ga0207660_10136575 Ga0207660_101365752 328
63 3300025986 Ga0207658_10090474 Ga0207658_100904742 328
64 3300046533 Ga0495640_0203914 Ga0495640_0203914_125_1153 331
65 3300047319 Ga0495674_0001564 Ga0495674_0001564_136_1164 331
66 3300014326 Ga0157380_10000132 Ga0157380_100001324 332
67 3300049744 Ga0501083_0002442 Ga0501083_0002442_1161_2189 332
68 3300049823 Ga0501044_0071712 Ga0501044_0071712_2239_3267 332
69 3300048911 Ga0496108_0000062 Ga0496108_0000062_94756_95778 333
70 3300048912 Ga0496109_0000007 Ga0496109_0000007_11060_12082 333
71 3300009098 Ga0105245_10014976 Ga0105245_100149763 338
72 3300013102 Ga0157371_10002993 Ga0157371_1000299310 338
73 3300025927 Ga0207687_10002500 Ga0207687_100025003 338
74 3300001979 JGI24740J21852_10000709 JGI24740J21852_100007099 339
75 3300005548 Ga0070665_100031438 Ga0070665_1000314382 339
76 3300028379 Ga0268266_10014316 Ga0268266_100143163 339
77 3300028381 Ga0268264_10270707 Ga0268264_102707072 339
78 3300005329 Ga0070683_100000336 Ga0070683_1000003367 340
79 3300005329 Ga0070683_100000619 Ga0070683_1000006199 340
80 3300005347 Ga0070668_100003873 Ga0070668_1000038732 340
81 3300005367 Ga0070667_100074383 Ga0070667_1000743832 340
82 3300005535 Ga0070684_100001455 Ga0070684_10000145510 340
83 3300005578 Ga0068854_100000136 Ga0068854_10000013624 340
84 3300005834 Ga0068851_10005831 Ga0068851_100058314 340
85 3300005842 Ga0068858_100000091 Ga0068858_10000009130 340
86 3300005844 Ga0068862_100001683 Ga0068862_1000016839 340
87 3300005937 Ga0081455_10005387 Ga0081455_1000538712 340
88 3300006175 Ga0070712_100010232 Ga0070712_1000102322 340
89 3300009553 Ga0105249_10031255 Ga0105249_100312552 340
90 3300014968 Ga0157379_10058852 Ga0157379_100588522 340
91 3300025321 Ga0207656_10000941 Ga0207656_100009412 340
92 3300025915 Ga0207693_10006565 Ga0207693_100065658 340
93 3300025944 Ga0207661_10000224 Ga0207661_100002244 340
94 3300025944 Ga0207661_10000262 Ga0207661_1000026219 340
95 3300025961 Ga0207712_10002551 Ga0207712_100025515 340
96 3300025972 Ga0207668_10131981 Ga0207668_101319812 340
97 3300025986 Ga0207658_10000789 Ga0207658_1000078920 340
98 3300026035 Ga0207703_10000152 Ga0207703_1000015231 340
99 3300028380 Ga0268265_10002694 Ga0268265_100026943 340
100 3300028381 Ga0268264_10051968 Ga0268264_100519682 340
101 3300046660 Ga0495625_0000696 Ga0495625_0000696_46631_47656 340
102 3300048911 Ga0496108_0002109 Ga0496108_0002109_3284_4306 340
103 3300048912 Ga0496109_0000129 Ga0496109_0000129_39069_40091 340
104 3300049581 Ga0501047_0185840 Ga0501047_0185840_249_1313 340
105 3300049586 Ga0501070_0009296 Ga0501070_0009296_3853_4878 340
106 3300049590 Ga0501074_0023297 Ga0501074_0023297_275_1339 340
107 3300049742 Ga0501080_0153654 Ga0501080_0153654_190_1254 340
108 3300049744 Ga0501083_0033618 Ga0501083_0033618_1026_2090 340
109 3300053085 Ga0495619_0000025 Ga0495619_0000025_18451_19473 340
110 3300005337 Ga0070682_100248183 Ga0070682_1002481831 341
111 3300005577 Ga0068857_100081918 Ga0068857_1000819182 341
112 3300046642 Ga0495634_0000018 Ga0495634_0000018_77744_78769 341
113 3300048905 Ga0496102_0341761 Ga0496102_0341761_161_1189 341
114 3300048920 Ga0496117_0015123 Ga0496117_0015123_3271_4299 341
115 3300048921 Ga0496118_0000818 Ga0496118_0000818_10070_11098 341
116 3300049742 Ga0501080_0408946 Ga0501080_0408946_65_1093 341
117 3300005535 Ga0070684_100137129 Ga0070684_1001371292 342
118 3300005841 Ga0068863_100024445 Ga0068863_1000244452 342
119 3300006852 Ga0075433_10113491 Ga0075433_101134913 342
120 3300013308 Ga0157375_10001152 Ga0157375_1000115216 342
121 3300025944 Ga0207661_10038056 Ga0207661_100380562 342
122 3300026088 Ga0207641_10005436 Ga0207641_100054365 342
123 3300046529 Ga0495652_0000019 Ga0495652_0000019_16073_17101 342
124 3300048907 Ga0496104_0000004 Ga0496104_0000004_204619_205647 342
125 3300048908 Ga0496105_0000001 Ga0496105_0000001_436184_437212 342
126 3300048912 Ga0496109_0195106 Ga0496109_0195106_73_1101 342
127 3300048922 Ga0496119_0020278 Ga0496119_0020278_3808_4836 342
128 3300050515 nmdc:mga0a205_540_c1 nmdc:mga0a205_540_c1_909_1937 342
129 3300005985 Ga0081539_10000791 Ga0081539_1000079134 343
130 3300009101 Ga0105247_10006073 Ga0105247_100060735 343
131 3300013297 Ga0157378_10003512 Ga0157378_100035126 343
132 3300025900 Ga0207710_10000195 Ga0207710_1000019528 343
133 3300045976 Ga0466967_0104080 Ga0466967_0104080_1344_2399 343
134 3300046476 Ga0495662_0060803 Ga0495662_0060803_28_1062 343
135 3300046516 Ga0495628_0000891 Ga0495628_0000891_11792_12829 343
136 3300046615 Ga0495656_0002145 Ga0495656_0002145_4469_5503 343
137 3300048088 Ga0495602_0000533 Ga0495602_0000533_9010_10047 343
138 3300048912 Ga0496109_0001311 Ga0496109_0001311_885_1922 343
139 3300048917 Ga0496114_0000014 Ga0496114_0000014_230041_231072 343
140 3300048918 Ga0496115_0000125 Ga0496115_0000125_51700_52731 343
141 3300049586 Ga0501070_0031626 Ga0501070_0031626_200_1231 343
142 3300001977 JGI24746J21847_1000158 JGI24746J21847_10001585 344
143 3300049578 Ga0501042_0208781 Ga0501042_0208781_30_1085 344

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

20

139

0.94

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

17

246

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ffv-assembly1.cif.gz_A human ppgalnact-2 complexed with manganese and udp 0.8518 2 215
7pho-assembly1.cif.gz_A crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 7.1 in complex with 4-hydroxybenzaldehyde 0.8505 3 118
7pho-assembly1.cif.gz_B crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 7.1 in complex with 4-hydroxybenzaldehyde 0.8489 3 118
7pvl-assembly1.cif.gz_B crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 8.5 - apo form 0.8404 3 120
7qib-assembly1.cif.gz_A crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 8.5 in complex with udp 0.839 3 121
ID Description Score Start End Superfamily
af_P9WMY3_4_248_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8589 4 223 3.90.550.10
1xhbA01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.826 1 215 3.90.550.10
4d11F00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8145 3 216 3.90.550.10
af_O74756_224_553_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8144 4 120 3.60.21.10
af_P36667_1_231_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.812 4 220 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A3B0UYP0-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.952 1 251
AF-A0A1G2BNV4-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9518 9 340 GO:0016020
AF-A0A838NNA0-F1-model_v4 Glycosyltransferase family 2 protein 0.9447 1 308 GO:0016020
GO:0016740
AF-A0A536LSH8-F1-model_v4 Glycosyltransferase family 2 protein 0.943 2 338 GO:0016020
GO:0016740
AF-A0A537ZP39-F1-model_v4 Glycosyltransferase 0.9411 3 113 GO:0016740

Feature Viewer

pLDDT pTM Quality
95.14 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map