F188092

General Info

Members Datasets Scaffolds Average Seq Length
143 94 286 338

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100000084|Ga0070707_10000008445
Length 360
Sequence MKILMLVSAYPSAMLLALWLMVVTTLAQPRNSFTVGSITAQAGEKSSGHIQVPAAKDEGTTIPITVVHGAKAGPVLALIAGNHGYEYTPIIALQRLLPRLDPKQMAGTVIMVHVANLPSFLRRTIYYSPVDGKNLNRVYPGKADGTVSERIAYQITKEVIERADYVLDLHCGDGNESLRPYSYWDVNAGDPSVVERSKQMALAFGLDHIVMDRDRPRDPAISIYCSTTAITRGKPAITVESGGLGVTDNESIARIERGVINLMRHLKMIEGPAQMVEHPLFIDRNEVLRSEATGIFYPLVERGHTVTKGTLLGYVTDFFGGRAFELRAPFSGAVLYILGTPPVSQGEPLAMIGHIAEAER

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
42 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
44 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
45 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
46 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
47 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
48 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
49 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
50 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
51 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
52 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
53 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
54 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
55 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
56 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
57 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
58 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
59 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
60 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
61 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
62 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
63 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
64 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
65 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
66 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
67 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
68 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
69 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
70 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
71 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
72 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
73 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
74 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
75 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
78 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
79 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
80 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
81 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
82 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
83 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
84 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
85 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
86 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
87 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
88 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
89 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
90 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
91 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
92 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
93 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
94 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 0.7
Rhizosphere 98.6
Stem 0
Stem Tuber 0
Unclassified 16.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100000084 3300005468 Bacteria 84547
2 Ga0065712_10068251 3300005290 Bacteria 12439
3 Ga0070683_100006196 3300005329 Bacteria 10031
4 Ga0070680_100006933 3300005336 Bacteria 8633
5 Ga0070669_100159667 3300005353 Bacteria 1751
6 Ga0070705_100015336 3300005440 Bacteria 3960
7 Ga0070700_100246969 3300005441 Bacteria 1278
8 Ga0070694_100001408 3300005444 Bacteria 14078
9 Ga0070694_100003489 3300005444 Bacteria 9409
10 Ga0070694_100006076 3300005444 Bacteria 7327
11 Ga0070694_100037617 3300005444 Bacteria 3210
12 Ga0070708_100131474 3300005445 Unclassified 2317
13 Ga0070708_100309609 3300005445 Bacteria 1487
14 Ga0070681_10064193 3300005458 Bacteria 3643
15 Ga0068867_100299482 3300005459 Bacteria 1325
16 Ga0070699_100111216 3300005518 Bacteria 2405
17 Ga0070699_100129091 3300005518 Bacteria 2228
18 Ga0070679_100049116 3300005530 Bacteria 4202
19 Ga0070679_100072739 3300005530 Bacteria 3430
20 Ga0070684_100050640 3300005535 Unclassified 3608
21 Ga0070684_100089665 3300005535 Unclassified 2733
22 Ga0070697_100005167 3300005536 Bacteria 10029
23 Ga0070697_100143787 3300005536 Bacteria 2007
24 Ga0070697_100225221 3300005536 Unclassified 1598
25 Ga0070704_100001640 3300005549 Bacteria 12128
26 Ga0070704_100029771 3300005549 Bacteria 3650
27 Ga0070704_100097837 3300005549 Bacteria 2203
28 Ga0068859_100165711 3300005617 Bacteria 2290
29 Ga0081455_10003429 3300005937 Bacteria 18222
30 Ga0075366_10127026 3300006195 Bacteria 1538
31 Ga0075428_100006281 3300006844 Bacteria 13210
32 Ga0075428_100011807 3300006844 Bacteria 9721
33 Ga0075428_100090488 3300006844 Bacteria 3338
34 Ga0075428_100242236 3300006844 Unclassified 1945
35 Ga0075430_100030269 3300006846 Bacteria 4596
36 Ga0075431_100010833 3300006847 Bacteria 9170
37 Ga0075431_100056772 3300006847 Unclassified 4038
38 Ga0075431_100071913 3300006847 Bacteria 3569
39 Ga0075431_100145376 3300006847 Bacteria 2443
40 Ga0075431_100164422 3300006847 Bacteria 2281
41 Ga0075433_10128690 3300006852 Unclassified 2249
42 Ga0075429_100061441 3300006880 Unclassified 3273
43 Ga0075429_100209532 3300006880 Unclassified 1708
44 Ga0075436_100002531 3300006914 Bacteria 12581
45 Ga0097620_100165696 3300006931 Bacteria 2290
46 Ga0105240_10003554 3300009093 Bacteria 24190
47 Ga0111539_10105456 3300009094 Bacteria 3306
48 Ga0111539_10141395 3300009094 Bacteria 2817
49 Ga0114129_10028227 3300009147 Bacteria 7950
50 Ga0114129_10082357 3300009147 Bacteria 4471
51 Ga0114129_10183814 3300009147 Bacteria 2843
52 Ga0114129_10215647 3300009147 Unclassified 2592
53 Ga0114129_10338359 3300009147 Unclassified 1997
54 Ga0114129_10415032 3300009147 Bacteria 1772
55 Ga0114129_10616121 3300009147 Bacteria 1404
56 Ga0105248_10021687 3300009177 Bacteria 7116
57 Ga0105248_10168072 3300009177 Bacteria 2472
58 Ga0105239_10056855 3300010375 Bacteria 4291
59 Ga0207684_10074861 3300025910 Bacteria 2877
60 Ga0207695_10137329 3300025913 Bacteria 2397
61 Ga0207660_10000066 3300025917 Bacteria 55362
62 Ga0207652_10055053 3300025921 Bacteria 3420
63 Ga0207646_10000173 3300025922 Bacteria 87043
64 Ga0207681_10095975 3300025923 Bacteria 2128
65 Ga0207711_10013553 3300025941 Bacteria 6769
66 Ga0207661_10007819 3300025944 Bacteria 7615
67 Ga0207661_10029084 3300025944 Bacteria 4241
68 Ga0207675_100010376 3300026118 Bacteria 8727
69 Ga0207428_10172377 3300027907 Bacteria 1638
70 Ga0268265_10344069 3300028380 Bacteria 1359
71 Ga0265331_10125440 3300031250 Bacteria 1173
72 Ga0307408_100363161 3300031548 Bacteria 1232
73 Ga0265314_10009168 3300031711 Bacteria 8395
74 Ga0265342_10066828 3300031712 Bacteria 2105
75 Ga0307405_10137214 3300031731 Bacteria 1700
76 Ga0307406_10191943 3300031901 Bacteria 1496
77 Ga0307409_100196468 3300031995 Bacteria 1801
78 Ga0307414_10450964 3300032004 Bacteria 1128
79 Ga0307411_10027360 3300032005 Bacteria 3449
80 Ga0307411_10106121 3300032005 Bacteria 1999
81 Ga0316583_10027782 3300032133 Bacteria 2020
82 Ga0373926_0019391 3300035083 Bacteria 2344
83 Ga0316574_0040490 3300035398 Bacteria 2870
84 Ga0373927_0005362 3300035695 Bacteria 8858
85 Ga0439431_0015018 3300041997 Bacteria 1799
86 Ga0439462_0010090 3300042015 Bacteria 2391
87 Ga0439460_0035712 3300042461 Bacteria 1439
88 Ga0439460_0037385 3300042461 Unclassified 1412
89 Ga0451577_0524338 3300042876 Unclassified 1076
90 Ga0453683_0005302 3300044673 Bacteria 9017
91 Ga0453683_0182106 3300044673 Bacteria 1333
92 Ga0453684_0050756 3300044712 Bacteria 5451
93 Ga0451576_0010548 3300045051 Bacteria 10582
94 Ga0495580_0020433 3300046472 Bacteria 4899
95 Ga0495582_0002860 3300046473 Bacteria 9662
96 Ga0495645_0009661 3300046543 Bacteria 6746
97 Ga0495599_0016073 3300046678 Bacteria 4644
98 Ga0495623_0061259 3300046679 Unclassified 2360
99 Ga0495658_0208913 3300046683 Unclassified 1219
100 Ga0495581_0091927 3300047315 Bacteria 1761
101 Ga0495674_0012262 3300047319 Bacteria 8079
102 Ga0495675_0024376 3300047444 Unclassified 3857
103 Ga0495684_0115104 3300047471 Unclassified 2027
104 Ga0496109_0000438 3300048912 Bacteria 36175
105 Ga0501299_018931 3300049522 Unclassified 1242
106 Ga0501039_0093487 3300049575 Bacteria 2344
107 Ga0501042_0271246 3300049578 Bacteria 1225
108 Ga0501071_0001281 3300049587 Bacteria 14292
109 Ga0501071_0024206 3300049587 Bacteria 4245
110 Ga0501072_0040391 3300049588 Bacteria 3664
111 Ga0501072_0043425 3300049588 Bacteria 3532
112 Ga0501072_0109539 3300049588 Bacteria 2198
113 Ga0501075_0014275 3300049591 Bacteria 5692
114 Ga0501075_0126053 3300049591 Bacteria 1949
115 Ga0501076_0089277 3300049592 Bacteria 2477
116 Ga0501076_0129752 3300049592 Bacteria 2044
117 Ga0501076_0242035 3300049592 Bacteria 1476
118 Ga0501076_0243599 3300049592 Unclassified 1471
119 Ga0501077_0034212 3300049593 Bacteria 3234
120 Ga0501077_0171751 3300049593 Bacteria 1377
121 Ga0501079_0174418 3300049741 Bacteria 1677
122 Ga0501081_0099570 3300049743 Bacteria 2054
123 Ga0501045_0035086 3300049824 Bacteria 3642
124 Ga0501045_0154025 3300049824 Bacteria 1710
125 nmdc:mga05p37_120975_c1 3300050507 Unclassified 3216
126 nmdc:mga05p37_16224_c1 3300050507 Bacteria 8967
127 nmdc:mga05p37_251014_c1 3300050507 Bacteria 2122
128 nmdc:mga05p37_29003_c1 3300050507 Bacteria 6753
129 nmdc:mga05p37_383917_c1 3300050507 Bacteria 1645
130 nmdc:mga05p37_540341_c1 3300050507 Unclassified 1329
131 nmdc:mga09592_178736_c1 3300050508 Bacteria 1835
132 nmdc:mga09592_22877_c1 3300050508 Bacteria 5156
133 nmdc:mga0qj67_13242_c1 3300050509 Bacteria 6223
134 nmdc:mga06r32_150528_c1 3300050510 Unclassified 2305
135 nmdc:mga06r32_334121_c1 3300050510 Archaea 1500
136 nmdc:mga06r32_34314_c1 3300050510 Bacteria 4784
137 nmdc:mga06r32_5787_c1 3300050510 Bacteria 11143
138 nmdc:mga08y16_25806_c1 3300050511 Bacteria 6201
139 nmdc:mga0n895_81494_c1 3300050512 Bacteria 3225
140 nmdc:mga0a205_55583_c1 3300050515 Bacteria 3823
141 Ga0501084_0067231 3300054114 Bacteria 3000
142 Ga0501082_0092515 3300060353 Unclassified 2612
143 Ga0530510_0077163 3300061734 Bacteria 2421
144 Ga0070707_100000084
145 Ga0065712_10068251
146 Ga0070683_100006196
147 Ga0070680_100006933
148 Ga0070669_100159667
149 Ga0070705_100015336
150 Ga0070700_100246969
151 Ga0070694_100001408
152 Ga0070694_100003489
153 Ga0070694_100006076
154 Ga0070694_100037617
155 Ga0070708_100131474
156 Ga0070708_100309609
157 Ga0070681_10064193
158 Ga0068867_100299482
159 Ga0070699_100111216
160 Ga0070699_100129091
161 Ga0070679_100049116
162 Ga0070679_100072739
163 Ga0070684_100050640
164 Ga0070684_100089665
165 Ga0070697_100005167
166 Ga0070697_100143787
167 Ga0070697_100225221
168 Ga0070704_100001640
169 Ga0070704_100029771
170 Ga0070704_100097837
171 Ga0068859_100165711
172 Ga0081455_10003429
173 Ga0075366_10127026
174 Ga0075428_100006281
175 Ga0075428_100011807
176 Ga0075428_100090488
177 Ga0075428_100242236
178 Ga0075430_100030269
179 Ga0075431_100010833
180 Ga0075431_100056772
181 Ga0075431_100071913
182 Ga0075431_100145376
183 Ga0075431_100164422
184 Ga0075433_10128690
185 Ga0075429_100061441
186 Ga0075429_100209532
187 Ga0075436_100002531
188 Ga0097620_100165696
189 Ga0105240_10003554
190 Ga0111539_10105456
191 Ga0111539_10141395
192 Ga0114129_10028227
193 Ga0114129_10082357
194 Ga0114129_10183814
195 Ga0114129_10215647
196 Ga0114129_10338359
197 Ga0114129_10415032
198 Ga0114129_10616121
199 Ga0105248_10021687
200 Ga0105248_10168072
201 Ga0105239_10056855
202 Ga0207684_10074861
203 Ga0207695_10137329
204 Ga0207660_10000066
205 Ga0207652_10055053
206 Ga0207646_10000173
207 Ga0207681_10095975
208 Ga0207711_10013553
209 Ga0207661_10007819
210 Ga0207661_10029084
211 Ga0207675_100010376
212 Ga0207428_10172377
213 Ga0268265_10344069
214 Ga0265331_10125440
215 Ga0307408_100363161
216 Ga0265314_10009168
217 Ga0265342_10066828
218 Ga0307405_10137214
219 Ga0307406_10191943
220 Ga0307409_100196468
221 Ga0307414_10450964
222 Ga0307411_10027360
223 Ga0307411_10106121
224 Ga0316583_10027782
225 Ga0373926_0019391
226 Ga0316574_0040490
227 Ga0373927_0005362
228 Ga0439431_0015018
229 Ga0439462_0010090
230 Ga0439460_0035712
231 Ga0439460_0037385
232 Ga0451577_0524338
233 Ga0453683_0005302
234 Ga0453683_0182106
235 Ga0453684_0050756
236 Ga0451576_0010548
237 Ga0495580_0020433
238 Ga0495582_0002860
239 Ga0495645_0009661
240 Ga0495599_0016073
241 Ga0495623_0061259
242 Ga0495658_0208913
243 Ga0495581_0091927
244 Ga0495674_0012262
245 Ga0495675_0024376
246 Ga0495684_0115104
247 Ga0496109_0000438
248 Ga0501299_018931
249 Ga0501039_0093487
250 Ga0501042_0271246
251 Ga0501071_0001281
252 Ga0501071_0024206
253 Ga0501072_0040391
254 Ga0501072_0043425
255 Ga0501072_0109539
256 Ga0501075_0014275
257 Ga0501075_0126053
258 Ga0501076_0089277
259 Ga0501076_0129752
260 Ga0501076_0242035
261 Ga0501076_0243599
262 Ga0501077_0034212
263 Ga0501077_0171751
264 Ga0501079_0174418
265 Ga0501081_0099570
266 Ga0501045_0035086
267 Ga0501045_0154025
268 nmdc:mga05p37_120975_c1
269 nmdc:mga05p37_16224_c1
270 nmdc:mga05p37_251014_c1
271 nmdc:mga05p37_29003_c1
272 nmdc:mga05p37_383917_c1
273 nmdc:mga05p37_540341_c1
274 nmdc:mga09592_178736_c1
275 nmdc:mga09592_22877_c1
276 nmdc:mga0qj67_13242_c1
277 nmdc:mga06r32_150528_c1
278 nmdc:mga06r32_334121_c1
279 nmdc:mga06r32_34314_c1
280 nmdc:mga06r32_5787_c1
281 nmdc:mga08y16_25806_c1
282 nmdc:mga0n895_81494_c1
283 nmdc:mga0a205_55583_c1
284 Ga0501084_0067231
285 Ga0501082_0092515
286 Ga0530510_0077163

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF24827

72

266

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bg5-assembly3.cif.gz_B crystal structure of staphylococcus aureus pyruvate carboxylase 0.8724 267 332
3hb9-assembly1.cif.gz_B crystal structure of s. aureus pyruvate carboxylase a610t mutant 0.8702 267 332
3hbl-assembly1.cif.gz_B crystal structure of s. aureus pyruvate carboxylase t908a mutant 0.8662 267 332
5vyz-assembly1.cif.gz_D crystal structure of lactococcus lactis pyruvate carboxylase in complex with cyclic-di-amp 0.8591 267 332
5vyz-assembly1.cif.gz_B crystal structure of lactococcus lactis pyruvate carboxylase in complex with cyclic-di-amp 0.8579 267 332
ID Description Score Start End Superfamily
af_Q9V9T5_626_691_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8758 268 330 2.40.50.100
af_Q2QMG2_656_731_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8734 267 332 2.40.50.100
af_A0A0R0HXH4_660_728_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8704 267 332 2.40.50.100
af_Q54KE6_633_699_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8697 268 332 2.40.50.100
af_P9WPQ3_584_653_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.868 264 332 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A2N9LGK9-F1-model_v4 Succinylglutamate desuccinylase/aspartoacylase 0.9859 24 336 GO:0016788
GO:0016811
GO:0046872
AF-A0A2V7IYR7-F1-model_v4 Succinylglutamate desuccinylase 0.9837 12 339 GO:0016788
GO:0046872
AF-A0A7W1H0I4-F1-model_v4 Succinylglutamate desuccinylase/aspartoacylase family protein 0.9832 82 336 GO:0016788
GO:0046872
AF-A0A1F5AU33-F1-model_v4 Succinylglutamate desuccinylase 0.9798 40 339 GO:0016788
GO:0016811
GO:0046872
AF-A0A2V7PSG7-F1-model_v4 Succinylglutamate desuccinylase 0.9753 10 194 GO:0016788
GO:0046872

Map