F188088

General Info

Members Datasets Scaffolds Average Seq Length
143 93 143 189

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100536327|Ga0070706_1005363272
Length 200
Sequence MNEGETELLAAVARIIGVFDELGVDYLVGGSIASSVFGEPRQTVDADLVARLLARHSEALVARLSGEFYVDLASIKSAIESQGCFNLIHLETMTKVDVFVRWRSPFGQSQLARRQKKFVGQTAPLELFFASPEDTVLAKLEWYRKGGEVSDRQWRDLLGVLRVQAGTLDRAYLDQWAGELGVADLLPRALEEAGLSESGS

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
21 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
34 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
35 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
47 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
48 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
49 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
50 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
51 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
52 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
53 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
54 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
55 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
56 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
57 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
58 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
59 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
60 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
63 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
64 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
65 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
66 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
67 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
68 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
69 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
70 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
71 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
72 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
76 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
77 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
78 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
79 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
80 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
81 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
82 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
83 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
84 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
85 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
86 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
87 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
88 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
89 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
90 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
91 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
92 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
93 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.4
Nodule 0
Rhizoplane 0
Rhizosphere 97.9
Stem 0
Stem Tuber 0
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_8077399 2162886012 Unclassified 1218
2 Ga0065707_10134925 3300005295 Unclassified 1857
3 Ga0065707_10309548 3300005295 Unclassified 987
4 Ga0065707_10402086 3300005295 Unclassified 851
5 Ga0070690_100040947 3300005330 Unclassified 2931
6 Ga0070690_100142248 3300005330 Bacteria 1629
7 Ga0068869_100013101 3300005334 Bacteria 5505
8 Ga0068869_100842793 3300005334 Unclassified 790
9 Ga0070689_100763965 3300005340 Bacteria 848
10 Ga0070687_100343525 3300005343 Unclassified 961
11 Ga0070673_100214302 3300005364 Unclassified 1664
12 Ga0070678_100346246 3300005456 Unclassified 1276
13 Ga0070662_100253160 3300005457 Unclassified 1416
14 Ga0068867_100210500 3300005459 Unclassified 1561
15 Ga0070706_100083596 3300005467 Bacteria 2957
16 Ga0070706_100220159 3300005467 Bacteria 1772
17 Ga0070706_100387023 3300005467 Bacteria 1302
18 Ga0070706_100536327 3300005467 Bacteria 1088
19 Ga0070698_100112627 3300005471 Bacteria 2685
20 Ga0070698_100710397 3300005471 Unclassified 947
21 Ga0070672_100107318 3300005543 Bacteria 2272
22 Ga0070695_101422857 3300005545 Unclassified 575
23 Ga0070702_100313692 3300005615 Bacteria 1090
24 Ga0068861_100820431 3300005719 Bacteria 874
25 Ga0068860_100054342 3300005843 Bacteria 3807
26 Ga0068862_100002644 3300005844 Bacteria 15768
27 Ga0075364_10128938 3300006051 Unclassified 1697
28 Ga0075427_10000206 3300006194 Bacteria 6041
29 Ga0068871_100460320 3300006358 Unclassified 1141
30 Ga0075428_100013437 3300006844 Bacteria 9110
31 Ga0075428_100215317 3300006844 Bacteria 2075
32 Ga0075428_101084540 3300006844 Unclassified 846
33 Ga0075430_100000811 3300006846 Bacteria 24342
34 Ga0075430_100384597 3300006846 Unclassified 1158
35 Ga0075430_100693009 3300006846 Unclassified 840
36 Ga0075431_100012166 3300006847 Bacteria 8684
37 Ga0075431_100041014 3300006847 Unclassified 4772
38 Ga0075431_100081075 3300006847 Bacteria 3350
39 Ga0075433_10004408 3300006852 Bacteria 10956
40 Ga0075433_10238609 3300006852 Bacteria 1614
41 Ga0075429_100219930 3300006880 Bacteria 1664
42 Ga0075429_100757520 3300006880 Bacteria 850
43 Ga0111539_10000517 3300009094 Bacteria 48951
44 Ga0111539_10058710 3300009094 Unclassified 4563
45 Ga0111539_10112715 3300009094 Unclassified 3190
46 Ga0111539_10191379 3300009094 Bacteria 2387
47 Ga0111539_10249937 3300009094 Unclassified 2065
48 Ga0105245_10230621 3300009098 Bacteria 1791
49 Ga0114129_10082294 3300009147 Bacteria 4473
50 Ga0114129_10298825 3300009147 Unclassified 2147
51 Ga0114129_10469789 3300009147 Bacteria 1647
52 Ga0114129_10989740 3300009147 Bacteria 1060
53 Ga0105246_10034475 3300011119 Unclassified 3374
54 Ga0157372_10694445 3300013307 Unclassified 1184
55 Ga0163163_10056246 3300014325 Unclassified 3888
56 Ga0157377_10002907 3300014745 Bacteria 7661
57 Ga0207673_1014304 3300025290 Bacteria 1046
58 Ga0207697_10005218 3300025315 Bacteria 6061
59 Ga0207645_10216619 3300025907 Unclassified 1261
60 Ga0207662_10268849 3300025918 Unclassified 1124
61 Ga0207670_10790651 3300025936 Bacteria 790
62 Ga0207691_10008429 3300025940 Bacteria 9900
63 Ga0207689_10009450 3300025942 Bacteria 8418
64 Ga0207689_10038894 3300025942 Bacteria 3938
65 Ga0207651_10116018 3300025960 Bacteria 2020
66 Ga0207708_10044496 3300026075 Unclassified 3383
67 Ga0207641_10399790 3300026088 Bacteria 1319
68 Ga0207648_10083085 3300026089 Bacteria 2793
69 Ga0207675_100018241 3300026118 Bacteria 6543
70 Ga0207428_10000921 3300027907 Bacteria 32868
71 Ga0207428_10033817 3300027907 Unclassified 4193
72 Ga0207428_10058564 3300027907 Unclassified 3056
73 Ga0265318_10097359 3300028577 Bacteria 1083
74 Ga0265323_10037425 3300028653 Bacteria 1778
75 Ga0316579_10212733 3300031691 Bacteria 935
76 Ga0316579_10323127 3300031691 Bacteria 746
77 Ga0316576_10135240 3300031727 Bacteria 1855
78 Ga0316576_10155806 3300031727 Unclassified 1722
79 Ga0316576_10592169 3300031727 Bacteria 810
80 Ga0316578_10024276 3300031728 Bacteria 3400
81 Ga0307413_10569458 3300031824 Unclassified 922
82 Ga0307407_10281751 3300031903 Bacteria 1152
83 Ga0307409_100890740 3300031995 Bacteria 903
84 Ga0307416_101673939 3300032002 Bacteria 741
85 Ga0373952_0023781 3300035092 Unclassified 1311
86 Ga0373939_0037904 3300035114 Bacteria 1435
87 Ga0373961_0000056 3300035241 Bacteria 65159
88 Ga0316574_0035012 3300035398 Unclassified 3066
89 Ga0373931_0130371 3300035691 Bacteria 1446
90 Ga0373937_1256807 3300036401 Unclassified 689
91 Ga0316582_0171053 3300036647 Unclassified 1475
92 Ga0316582_0220380 3300036647 Bacteria 1297
93 Ga0316582_0266134 3300036647 Unclassified 1176
94 Ga0316584_0050414 3300036712 Unclassified 3112
95 Ga0436365_1732231 3300039437 Bacteria 3263
96 Ga0451577_0047857 3300042876 Bacteria 3821
97 Ga0451577_0054678 3300042876 Bacteria 3564
98 Ga0453683_0324233 3300044673 Bacteria 987
99 Ga0453684_0040042 3300044712 Bacteria 6372
100 Ga0453684_0054918 3300044712 Bacteria 5183
101 Ga0453684_0056545 3300044712 Bacteria 5088
102 Ga0453684_0135408 3300044712 Bacteria 2951
103 Ga0453684_0270710 3300044712 Bacteria 1941
104 Ga0451576_0033732 3300045051 Bacteria 5439
105 Ga0451576_0054042 3300045051 Bacteria 4205
106 Ga0451576_0319870 3300045051 Bacteria 1623
107 Ga0495645_0061844 3300046543 Bacteria 2713
108 Ga0495600_0203971 3300046809 Unclassified 1269
109 Ga0495604_0282009 3300047317 Unclassified 1122
110 Ga0501036_0464283 3300049572 Bacteria 1054
111 Ga0501040_0123368 3300049576 Bacteria 1819
112 Ga0501048_0323812 3300049582 Bacteria 1098
113 Ga0501071_0319094 3300049587 Unclassified 1180
114 Ga0501071_0458549 3300049587 Bacteria 976
115 Ga0501072_0479410 3300049588 Bacteria 984
116 Ga0501073_0089127 3300049589 Unclassified 2145
117 Ga0501075_0172689 3300049591 Unclassified 1650
118 Ga0501076_0001905 3300049592 Bacteria 14242
119 Ga0501076_0824223 3300049592 Unclassified 765
120 Ga0501081_0169328 3300049743 Bacteria 1577
121 Ga0501083_0051415 3300049744 Bacteria 2771
122 Ga0501045_0460714 3300049824 Bacteria 945
123 nmdc:mga00v17_71523_c1 3300050491 Bacteria 2150
124 nmdc:mga05p37_104896_c1 3300050507 Unclassified 3478
125 nmdc:mga05p37_388008_c1 3300050507 Unclassified 1634
126 nmdc:mga09592_243624_c1 3300050508 Bacteria 1558
127 nmdc:mga09592_61086_c1 3300050508 Unclassified 3187
128 nmdc:mga0qj67_12364_c1 3300050509 Bacteria 6430
129 nmdc:mga0qj67_153630_c1 3300050509 Bacteria 1867
130 nmdc:mga0qj67_270076_c1 3300050509 Bacteria 1379
131 nmdc:mga06r32_178310_c1 3300050510 Bacteria 2110
132 nmdc:mga06r32_5422_c1 3300050510 Bacteria 11479
133 nmdc:mga06r32_68561_c1 3300050510 Bacteria 3427
134 nmdc:mga08y16_205014_c1 3300050511 Unclassified 2043
135 nmdc:mga08y16_25599_c1 3300050511 Bacteria 6225
136 nmdc:mga08y16_474_c1 3300050511 Bacteria 37024
137 nmdc:mga08y16_626610_c1 3300050511 Bacteria 1082
138 nmdc:mga08y16_8505_c1 3300050511 Bacteria 10748
139 nmdc:mga0a205_67585_c1 3300050515 Bacteria 3452
140 Ga0495601_0693350 3300053077 Unclassified 650
141 Ga0501084_0290147 3300054114 Bacteria 1382
142 Ga0501082_0756114 3300060353 Bacteria 851
143 Ga0530510_0756147 3300061734 Bacteria 741

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005545 Ga0070695_101422857 Ga0070695_1014228571 151
2 3300005459 Ga0068867_100210500 Ga0068867_1002105001 153
3 3300036401 Ga0373937_1256807 Ga0373937_1256807_142_639 163
4 3300005471 Ga0070698_100710397 Ga0070698_1007103971 164
5 3300009147 Ga0114129_10989740 Ga0114129_109897401 164
6 3300031727 Ga0316576_10135240 Ga0316576_101352403 166
7 3300031728 Ga0316578_10024276 Ga0316578_100242763 166
8 3300046543 Ga0495645_0061844 Ga0495645_0061844_1003_1596 168
9 3300046809 Ga0495600_0203971 Ga0495600_0203971_171_764 168
10 3300047317 Ga0495604_0282009 Ga0495604_0282009_475_1068 168
11 3300049588 Ga0501072_0479410 Ga0501072_0479410_438_944 168
12 3300050507 nmdc:mga05p37_388008_c1 nmdc:mga05p37_388008_c1_458_964 168
13 3300050509 nmdc:mga0qj67_12364_c1 nmdc:mga0qj67_12364_c1_5276_5782 168
14 3300053077 Ga0495601_0693350 Ga0495601_0693350_21_614 168
15 3300031691 Ga0316579_10212733 Ga0316579_102127332 174
16 3300039437 Ga0436365_1732231 Ga0436365_1732231_2676_3230 181
17 3300028577 Ga0265318_10097359 Ga0265318_100973592 182
18 3300054114 Ga0501084_0290147 Ga0501084_0290147_35_586 182
19 3300060353 Ga0501082_0756114 Ga0501082_0756114_174_725 182
20 3300005334 Ga0068869_100842793 Ga0068869_1008427932 183
21 3300025942 Ga0207689_10038894 Ga0207689_100388944 183
22 3300032002 Ga0307416_101673939 Ga0307416_1016739392 183
23 3300044712 Ga0453684_0135408 Ga0453684_0135408_32_586 183
24 3300049589 Ga0501073_0089127 Ga0501073_0089127_597_1166 183
25 3300005467 Ga0070706_100220159 Ga0070706_1002201592 184
26 3300006846 Ga0075430_100693009 Ga0075430_1006930092 184
27 3300006847 Ga0075431_100081075 Ga0075431_1000810753 184
28 3300036647 Ga0316582_0171053 Ga0316582_0171053_424_996 184
29 3300044712 Ga0453684_0270710 Ga0453684_0270710_588_1148 184
30 3300049587 Ga0501071_0458549 Ga0501071_0458549_368_928 184
31 3300050509 nmdc:mga0qj67_153630_c1 nmdc:mga0qj67_153630_c1_600_1157 184
32 3300050510 nmdc:mga06r32_68561_c1 nmdc:mga06r32_68561_c1_1592_2149 184
33 3300005295 Ga0065707_10134925 Ga0065707_101349253 185
34 3300005295 Ga0065707_10402086 Ga0065707_104020862 185
35 3300005343 Ga0070687_100343525 Ga0070687_1003435252 185
36 3300005467 Ga0070706_100083596 Ga0070706_1000835962 185
37 3300005467 Ga0070706_100387023 Ga0070706_1003870232 185
38 3300005471 Ga0070698_100112627 Ga0070698_1001126272 185
39 3300006051 Ga0075364_10128938 Ga0075364_101289383 185
40 3300006194 Ga0075427_10000206 Ga0075427_100002063 185
41 3300006844 Ga0075428_100215317 Ga0075428_1002153176 185
42 3300006846 Ga0075430_100384597 Ga0075430_1003845973 185
43 3300006847 Ga0075431_100041014 Ga0075431_1000410142 185
44 3300006852 Ga0075433_10238609 Ga0075433_102386093 185
45 3300009098 Ga0105245_10230621 Ga0105245_102306213 185
46 3300009147 Ga0114129_10082294 Ga0114129_100822944 185
47 3300009147 Ga0114129_10469789 Ga0114129_104697892 185
48 3300025918 Ga0207662_10268849 Ga0207662_102688492 185
49 3300031995 Ga0307409_100890740 Ga0307409_1008907402 185
50 3300042876 Ga0451577_0054678 Ga0451577_0054678_1047_1622 185
51 3300044673 Ga0453683_0324233 Ga0453683_0324233_191_766 185
52 3300044712 Ga0453684_0040042 Ga0453684_0040042_5196_5771 185
53 3300044712 Ga0453684_0054918 Ga0453684_0054918_1308_1904 185
54 3300045051 Ga0451576_0033732 Ga0451576_0033732_1565_2140 185
55 3300049587 Ga0501071_0319094 Ga0501071_0319094_133_708 185
56 3300049824 Ga0501045_0460714 Ga0501045_0460714_261_836 185
57 3300050491 nmdc:mga00v17_71523_c1 nmdc:mga00v17_71523_c1_734_1297 185
58 3300050507 nmdc:mga05p37_104896_c1 nmdc:mga05p37_104896_c1_1428_2018 185
59 3300050508 nmdc:mga09592_61086_c1 nmdc:mga09592_61086_c1_1698_2288 185
60 3300050509 nmdc:mga0qj67_270076_c1 nmdc:mga0qj67_270076_c1_159_734 185
61 3300050510 nmdc:mga06r32_178310_c1 nmdc:mga06r32_178310_c1_174_749 185
62 3300050515 nmdc:mga0a205_67585_c1 nmdc:mga0a205_67585_c1_2813_3376 185
63 3300028653 Ga0265323_10037425 Ga0265323_100374252 186
64 3300031824 Ga0307413_10569458 Ga0307413_105694582 186
65 3300031903 Ga0307407_10281751 Ga0307407_102817511 186
66 3300042876 Ga0451577_0047857 Ga0451577_0047857_2651_3229 186
67 3300044712 Ga0453684_0056545 Ga0453684_0056545_343_921 186
68 3300049744 Ga0501083_0051415 Ga0501083_0051415_1134_1715 186
69 3300006880 Ga0075429_100757520 Ga0075429_1007575202 187
70 3300009094 Ga0111539_10000517 Ga0111539_1000051735 187
71 3300009094 Ga0111539_10058710 Ga0111539_100587103 187
72 3300009094 Ga0111539_10191379 Ga0111539_101913792 187
73 3300009094 Ga0111539_10249937 Ga0111539_102499372 187
74 3300027907 Ga0207428_10000921 Ga0207428_1000092113 187
75 3300027907 Ga0207428_10058564 Ga0207428_100585642 187
76 3300031727 Ga0316576_10155806 Ga0316576_101558062 187
77 3300035241 Ga0373961_0000056 Ga0373961_0000056_57880_58458 187
78 3300035398 Ga0316574_0035012 Ga0316574_0035012_370_954 187
79 3300036647 Ga0316582_0266134 Ga0316582_0266134_319_906 187
80 3300036712 Ga0316584_0050414 Ga0316584_0050414_2325_2909 187
81 3300049592 Ga0501076_0824223 Ga0501076_0824223_157_723 187
82 3300050511 nmdc:mga08y16_205014_c1 nmdc:mga08y16_205014_c1_161_745 187
83 3300050511 nmdc:mga08y16_25599_c1 nmdc:mga08y16_25599_c1_3330_3914 187
84 3300050511 nmdc:mga08y16_474_c1 nmdc:mga08y16_474_c1_27633_28211 187
85 3300050511 nmdc:mga08y16_626610_c1 nmdc:mga08y16_626610_c1_449_1039 187
86 3300005330 Ga0070690_100142248 Ga0070690_1001422482 188
87 3300005340 Ga0070689_100763965 Ga0070689_1007639652 188
88 3300005467 Ga0070706_100536327 Ga0070706_1005363272 188
89 3300006844 Ga0075428_101084540 Ga0075428_1010845401 188
90 3300006880 Ga0075429_100219930 Ga0075429_1002199302 188
91 3300013307 Ga0157372_10694445 Ga0157372_106944452 188
92 3300014325 Ga0163163_10056246 Ga0163163_100562463 188
93 3300025936 Ga0207670_10790651 Ga0207670_107906511 188
94 3300026088 Ga0207641_10399790 Ga0207641_103997903 188
95 3300031691 Ga0316579_10323127 Ga0316579_103231271 188
96 3300031727 Ga0316576_10592169 Ga0316576_105921692 188
97 3300035092 Ga0373952_0023781 Ga0373952_0023781_195_782 188
98 3300035691 Ga0373931_0130371 Ga0373931_0130371_472_1068 188
99 3300036647 Ga0316582_0220380 Ga0316582_0220380_346_936 188
100 3300045051 Ga0451576_0054042 Ga0451576_0054042_2464_3060 188
101 3300045051 Ga0451576_0319870 Ga0451576_0319870_60_647 188
102 3300049591 Ga0501075_0172689 Ga0501075_0172689_947_1534 188
103 3300049743 Ga0501081_0169328 Ga0501081_0169328_875_1462 188
104 3300050508 nmdc:mga09592_243624_c1 nmdc:mga09592_243624_c1_41_640 188
105 3300061734 Ga0530510_0756147 Ga0530510_0756147_111_698 188
106 2162886012 MBSR1b_contig_8077399 MBSR1b_0916.00003590 189
107 3300005295 Ga0065707_10309548 Ga0065707_103095481 189
108 3300005330 Ga0070690_100040947 Ga0070690_1000409473 189
109 3300005334 Ga0068869_100013101 Ga0068869_1000131013 189
110 3300005364 Ga0070673_100214302 Ga0070673_1002143022 189
111 3300005456 Ga0070678_100346246 Ga0070678_1003462461 189
112 3300005457 Ga0070662_100253160 Ga0070662_1002531603 189
113 3300005543 Ga0070672_100107318 Ga0070672_1001073183 189
114 3300005615 Ga0070702_100313692 Ga0070702_1003136921 189
115 3300005719 Ga0068861_100820431 Ga0068861_1008204312 189
116 3300005843 Ga0068860_100054342 Ga0068860_1000543423 189
117 3300005844 Ga0068862_100002644 Ga0068862_1000026443 189
118 3300006358 Ga0068871_100460320 Ga0068871_1004603201 189
119 3300006844 Ga0075428_100013437 Ga0075428_1000134373 189
120 3300006846 Ga0075430_100000811 Ga0075430_1000008118 189
121 3300006847 Ga0075431_100012166 Ga0075431_1000121662 189
122 3300006852 Ga0075433_10004408 Ga0075433_100044084 189
123 3300009094 Ga0111539_10112715 Ga0111539_101127153 189
124 3300009147 Ga0114129_10298825 Ga0114129_102988252 189
125 3300011119 Ga0105246_10034475 Ga0105246_100344753 189
126 3300014745 Ga0157377_10002907 Ga0157377_100029071 189
127 3300025290 Ga0207673_1014304 Ga0207673_10143041 189
128 3300025315 Ga0207697_10005218 Ga0207697_100052181 189
129 3300025907 Ga0207645_10216619 Ga0207645_102166192 189
130 3300025940 Ga0207691_10008429 Ga0207691_100084293 189
131 3300025942 Ga0207689_10009450 Ga0207689_100094506 189
132 3300025960 Ga0207651_10116018 Ga0207651_101160182 189
133 3300026075 Ga0207708_10044496 Ga0207708_100444962 189
134 3300026089 Ga0207648_10083085 Ga0207648_100830853 189
135 3300026118 Ga0207675_100018241 Ga0207675_1000182412 189
136 3300027907 Ga0207428_10033817 Ga0207428_100338173 189
137 3300035114 Ga0373939_0037904 Ga0373939_0037904_433_1002 189
138 3300049572 Ga0501036_0464283 Ga0501036_0464283_146_718 189
139 3300049576 Ga0501040_0123368 Ga0501040_0123368_109_681 189
140 3300049582 Ga0501048_0323812 Ga0501048_0323812_79_651 189
141 3300049592 Ga0501076_0001905 Ga0501076_0001905_13395_13967 189
142 3300050510 nmdc:mga06r32_5422_c1 nmdc:mga06r32_5422_c1_1239_1808 189
143 3300050511 nmdc:mga08y16_8505_c1 nmdc:mga08y16_8505_c1_7443_8012 189

Structural Annotation

Top 5 Hits

ID Description Score Start End
8an5-assembly1.cif.gz_B menat1 toxin-antitoxin complex (rv0078a-rv0078b) from mycobacterium tuberculosis h37rv 0.7717 4 172
8an4-assembly2.cif.gz_B ment1 toxin (rv0078a) from mycobacterium tuberculosis h37rv 0.7695 1 172
8an4-assembly1.cif.gz_A ment1 toxin (rv0078a) from mycobacterium tuberculosis h37rv 0.7536 1 182
8an5-assembly1.cif.gz_A menat1 toxin-antitoxin complex (rv0078a-rv0078b) from mycobacterium tuberculosis h37rv 0.7409 1 184
8an4-assembly1.cif.gz_A ment1 toxin (rv0078a) from mycobacterium tuberculosis h37rv 0.7258 1 182
ID Description Score Start End Superfamily
af_Q54Z78_22_111_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.832 80 96 2.60.40.420
af_P87229_162_345_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8036 79 102 2.130.10.10
af_L7N686_1_158_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.7629 1 154 3.30.460.40
af_L7N686_1_158_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.7413 1 154 3.30.460.40
af_K7M3R7_315_801_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.6722 126 173 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A7Y5SQL2-F1-model_v4 Nucleotidyltransferase 0.9638 6 184
AF-A0A318CVW7-F1-model_v4 Nucleotidyltransferase family protein 0.9611 1 187
AF-A0A2A2RKH3-F1-model_v4 Nucleotidyltransferase 0.9587 1 182
AF-A0A1F8S1Z8-F1-model_v4 Nucleotidyltransferase family protein 0.9573 1 182
AF-F7YVR5-F1-model_v4 DNA polymerase beta domain protein region 0.9571 1 184

Feature Viewer

pLDDT pTM Quality
92.12 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map