F188064

General Info

Members Datasets Scaffolds Average Seq Length
143 110 141 241

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10015948|Ga0070681_100159482
Length 267
Sequence MSGPGVRAALERPPEREGHSEAVLSAAIASSRYGAVEVLRDLHVEVGAGEIVAVLGANGAGKTTLLRTISGILVKAAAEVHLDGEDVSRLSAPRRVRAGLVHVPEGRRIFPDLTVAENLEVAGRASRRQAAGMAAGLERVFDLFPRLAERRRQRGSSLSGGEQQMLAIGRGLMAEPRLLMVDEASLGLSPTATEEMFAALAGLGAGGLGVLLVEQNARASLQIADRAYILERGTVSISGPAAELLGDERVAATYLGGHLSAAEGPDP

Samples

Sample ID Description Type Environment
1 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
37 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
38 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
42 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
43 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
53 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
54 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
55 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
56 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
57 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
58 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
64 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
65 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
66 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
67 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
68 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
69 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
70 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
71 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
72 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
73 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
74 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
75 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
76 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
79 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
82 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
83 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
84 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
85 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
86 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
87 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
88 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
91 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
92 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
97 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
98 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
99 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
100 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
101 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
102 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
103 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
106 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
107 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
108 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
109 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
110 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.6
Metatranscriptomes 0
Isolates 1.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.69
Nodule 0
Rhizoplane 1.4
Rhizosphere 83.22
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002752 3300001979 Bacteria 7863
2 JGI25156J39149_1016025 3300002705 Bacteria 1475
3 JGI25154J39366_1000972 3300002738 Bacteria 11718
4 Ga0055533_1001219 3300003756 Bacteria 7159
5 Ga0055542_1003782 3300003762 Bacteria 3938
6 Ga0055541_1000505 3300003841 Bacteria 10883
7 Ga0070658_10002333 3300005327 Bacteria 15925
8 Ga0070683_100530532 3300005329 Bacteria 1125
9 Ga0068869_100240186 3300005334 Bacteria 1443
10 Ga0070708_100000344 3300005445 Bacteria 35030
11 Ga0070708_100002684 3300005445 Bacteria 13791
12 Ga0070708_100006565 3300005445 Bacteria 9257
13 Ga0070708_100009383 3300005445 Bacteria 7887
14 Ga0070708_100171103 3300005445 Bacteria 2028
15 Ga0070708_100213925 3300005445 Bacteria 1806
16 Ga0070708_100306040 3300005445 Bacteria 1497
17 Ga0070708_100536590 3300005445 Bacteria 1104
18 Ga0070681_10015948 3300005458 Bacteria 7493
19 Ga0070681_10017722 3300005458 Bacteria 7117
20 Ga0070681_10133264 3300005458 Bacteria 2416
21 Ga0068867_100477854 3300005459 Bacteria 1067
22 Ga0070706_100005067 3300005467 Bacteria 12585
23 Ga0070706_100093161 3300005467 Bacteria 2795
24 Ga0070706_100099552 3300005467 Bacteria 2701
25 Ga0070706_100219117 3300005467 Bacteria 1776
26 Ga0070707_100152125 3300005468 Bacteria 2253
27 Ga0070707_100248057 3300005468 Bacteria 1733
28 Ga0070699_100016436 3300005518 Bacteria 6355
29 Ga0070699_100021950 3300005518 Bacteria 5500
30 Ga0070684_100143813 3300005535 Bacteria 2158
31 Ga0070697_100137608 3300005536 Bacteria 2052
32 Ga0070696_100214245 3300005546 Bacteria 1443
33 Ga0068855_100097926 3300005563 Bacteria 3379
34 Ga0068855_100213573 3300005563 Bacteria 2167
35 Ga0068855_100252168 3300005563 Bacteria 1968
36 Ga0081539_10001863 3300005985 Bacteria 33168
37 Ga0075365_10000490 3300006038 Bacteria 15073
38 Ga0075363_100004017 3300006048 Bacteria 6363
39 Ga0075432_10150771 3300006058 Bacteria 893
40 Ga0070712_100851639 3300006175 Bacteria 784
41 Ga0075428_100000246 3300006844 Bacteria 53194
42 Ga0075431_100000581 3300006847 Bacteria 30959
43 Ga0075436_100002515 3300006914 Bacteria 12610
44 Ga0075435_100064239 3300007076 Bacteria 2982
45 Ga0105245_10095112 3300009098 Bacteria 2748
46 Ga0114129_11117647 3300009147 Bacteria 986
47 Ga0105028_102180 3300009993 Bacteria 2058
48 Ga0157370_10608505 3300013104 Unclassified 1000
49 Ga0157369_10003480 3300013105 Bacteria 18681
50 Ga0157372_10802130 3300013307 Bacteria 1094
51 Ga0182006_1033110 3300015261 Bacteria 2073
52 Ga0182007_10047709 3300015262 Bacteria 1416
53 Ga0209784_100430 3300025224 Bacteria 18322
54 Ga0209566_100596 3300025225 Bacteria 22719
55 Ga0209674_100201 3300025226 Bacteria 61586
56 Ga0209646_1000035 3300025246 Bacteria 363209
57 Ga0209026_1005045 3300025250 Bacteria 3688
58 Ga0209148_1000077 3300025254 Bacteria 298133
59 Ga0207647_10058657 3300025904 Bacteria 2357
60 Ga0207705_10002091 3300025909 Bacteria 15523
61 Ga0207684_10011255 3300025910 Bacteria 7836
62 Ga0207684_10039660 3300025910 Bacteria 3993
63 Ga0207684_10060352 3300025910 Bacteria 3221
64 Ga0207684_10072770 3300025910 Bacteria 2919
65 Ga0207684_10513850 3300025910 Bacteria 1026
66 Ga0207707_10059223 3300025912 Bacteria 3332
67 Ga0207707_10120767 3300025912 Bacteria 2291
68 Ga0207707_10185345 3300025912 Bacteria 1816
69 Ga0207707_10355663 3300025912 Bacteria 1261
70 Ga0207652_10322856 3300025921 Bacteria 1394
71 Ga0207646_10007429 3300025922 Bacteria 11136
72 Ga0207667_10129688 3300025949 Bacteria 2597
73 Ga0207667_10188981 3300025949 Bacteria 2114
74 Ga0207648_10470212 3300026089 Bacteria 1147
75 Ga0316176_1152868 3300030732 Bacteria 872
76 Ga0314311_1079049 3300030733 Bacteria 861
77 Ga0265332_10070729 3300031238 Bacteria 1486
78 Ga0265340_10047487 3300031247 Bacteria 2090
79 Ga0265339_10023673 3300031249 Bacteria 3548
80 Ga0265327_10029064 3300031251 Bacteria 3149
81 Ga0265327_10197648 3300031251 Bacteria 912
82 Ga0307513_10000009 3300031456 Bacteria 403893
83 Ga0307513_10207119 3300031456 Bacteria 1796
84 Ga0307513_10471989 3300031456 Bacteria 976
85 Ga0307408_100452273 3300031548 Bacteria 1114
86 Ga0265314_10062870 3300031711 Bacteria 2521
87 Ga0307407_10255842 3300031903 Bacteria 1202
88 Ga0307416_100137907 3300032002 Bacteria 2211
89 Ga0316583_10095555 3300032133 Bacteria 1036
90 Ga0373930_0005848 3300034816 Bacteria 2059
91 Ga0373932_0000396 3300035112 Bacteria 13430
92 Ga0373931_0000057 3300035691 Bacteria 56670
93 Ga0436365_0102759 3300039437 Bacteria 44403
94 Ga0436360_0384424 3300039438 Bacteria 3289
95 Ga0436361_0283896 3300039447 Bacteria 5981
96 Ga0436362_0370071 3300039453 Bacteria 1161
97 Ga0436362_1170263 3300039453 Bacteria 1713
98 Ga0436362_1173420 3300039453 Bacteria 6036
99 Ga0439438_008612 3300041405 Bacteria 3367
100 Ga0439438_023883 3300041405 Bacteria 1680
101 Ga0439439_0008368 3300041406 Bacteria 2443
102 Ga0439449_0016506 3300042007 Bacteria 2774
103 Ga0439457_001831 3300042014 Bacteria 6277
104 Ga0439434_0085049 3300042435 Bacteria 1007
105 Ga0466972_0167702 3300044658 Bacteria 1031
106 Ga0466966_0018580 3300044684 Bacteria 4583
107 Ga0466966_0165297 3300044684 Bacteria 1346
108 Ga0466961_0025053 3300044693 Bacteria 3839
109 Ga0466961_0054864 3300044693 Bacteria 2542
110 Ga0466963_0235963 3300044694 Bacteria 1282
111 Ga0466957_0098186 3300044842 Bacteria 1843
112 Ga0466959_0034085 3300045049 Bacteria 3767
113 Ga0466958_0284835 3300045836 Bacteria 1059
114 Ga0495638_0206355 3300046460 Bacteria 1106
115 Ga0495584_0018795 3300046491 Bacteria 3513
116 Ga0495584_0164997 3300046491 Bacteria 1126
117 Ga0495607_0000087 3300046501 Bacteria 95985
118 Ga0495669_0003938 3300046684 Bacteria 6115
119 Ga0495674_0221199 3300047319 Bacteria 1565
120 Ga0495676_0387734 3300047321 Bacteria 929
121 Ga0496104_0263552 3300048907 Bacteria 1636
122 Ga0496115_0073344 3300048918 Bacteria 2778
123 Ga0496116_0101023 3300048919 Bacteria 1723
124 Ga0496117_0085454 3300048920 Bacteria 2054
125 Ga0501034_0170581 3300049571 Bacteria 2143
126 Ga0501040_0221981 3300049576 Bacteria 1345
127 Ga0501043_0016691 3300049579 Bacteria 5754
128 Ga0501068_0219391 3300049584 Bacteria 1209
129 Ga0501069_0065983 3300049585 Bacteria 2024
130 Ga0501075_0096691 3300049591 Bacteria 2241
131 Ga0501076_0267892 3300049592 Bacteria 1399
132 Ga0501079_0294316 3300049741 Bacteria 1270
133 Ga0501045_0275406 3300049824 Bacteria 1253
134 nmdc:mga03n38_3368_c1 3300050490 Bacteria 5121
135 nmdc:mga0yw44_310_c1 3300050492 Bacteria 16920
136 nmdc:mga05p37_976464_c1 3300050507 Bacteria 903
137 nmdc:mga0qj67_317658_c1 3300050509 Bacteria 1261
138 nmdc:mga06r32_2244_c1 3300050510 Bacteria 17285
139 nmdc:mga0rr50_112406_c1 3300050513 Bacteria 2157
140 nmdc:mga08x19_762_c1 3300050514 Bacteria 20508
141 Ga0530510_0331383 3300061734 Bacteria 1142

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100306040 Ga0070708_1003060401 225
2 3300005468 Ga0070707_100152125 Ga0070707_1001521252 225
3 3300005468 Ga0070707_100248057 Ga0070707_1002480573 225
4 3300005518 Ga0070699_100021950 Ga0070699_1000219503 225
5 3300025922 Ga0207646_10007429 Ga0207646_100074293 225
6 3300006175 Ga0070712_100851639 Ga0070712_1008516391 227
7 iso_pu_bacteria 2857576091 2857576439 229
8 iso_pu_bacteria 8056054917 8056058083 229
9 3300005334 Ga0068869_100240186 Ga0068869_1002401862 230
10 3300013105 Ga0157369_10003480 Ga0157369_100034807 230
11 3300025912 Ga0207707_10355663 Ga0207707_103556631 230
12 3300039437 Ga0436365_0102759 Ga0436365_0102759_39540_40238 230
13 3300039453 Ga0436362_0370071 Ga0436362_0370071_30_728 230
14 3300044684 Ga0466966_0165297 Ga0466966_0165297_32_733 230
15 3300044693 Ga0466961_0025053 Ga0466961_0025053_1135_1836 230
16 3300044694 Ga0466963_0235963 Ga0466963_0235963_335_1036 230
17 3300044842 Ga0466957_0098186 Ga0466957_0098186_727_1428 230
18 3300045049 Ga0466959_0034085 Ga0466959_0034085_183_884 230
19 3300045836 Ga0466958_0284835 Ga0466958_0284835_315_1016 230
20 3300049824 Ga0501045_0275406 Ga0501045_0275406_316_1020 230
21 3300006038 Ga0075365_10000490 Ga0075365_100004903 231
22 3300013104 Ga0157370_10608505 Ga0157370_106085052 231
23 3300030732 Ga0316176_1152868 Ga0316176_11528681 231
24 3300030733 Ga0314311_1079049 Ga0314311_10790491 231
25 3300031251 Ga0265327_10029064 Ga0265327_100290643 231
26 3300031251 Ga0265327_10197648 Ga0265327_101976481 231
27 3300031456 Ga0307513_10000009 Ga0307513_1000000937 231
28 3300031903 Ga0307407_10255842 Ga0307407_102558422 231
29 3300032133 Ga0316583_10095555 Ga0316583_100955552 231
30 3300034816 Ga0373930_0005848 Ga0373930_0005848_592_1296 231
31 3300035112 Ga0373932_0000396 Ga0373932_0000396_3882_4586 231
32 3300035691 Ga0373931_0000057 Ga0373931_0000057_13341_14045 231
33 3300041405 Ga0439438_008612 Ga0439438_008612_2058_2765 231
34 3300041405 Ga0439438_023883 Ga0439438_023883_59_766 231
35 3300041406 Ga0439439_0008368 Ga0439439_0008368_676_1383 231
36 3300042007 Ga0439449_0016506 Ga0439449_0016506_628_1335 231
37 3300042014 Ga0439457_001831 Ga0439457_001831_1589_2296 231
38 3300046501 Ga0495607_0000087 Ga0495607_0000087_51269_51970 231
39 3300049576 Ga0501040_0221981 Ga0501040_0221981_264_971 231
40 3300049584 Ga0501068_0219391 Ga0501068_0219391_154_861 231
41 3300049585 Ga0501069_0065983 Ga0501069_0065983_1056_1763 231
42 3300049741 Ga0501079_0294316 Ga0501079_0294316_261_968 231
43 3300050492 nmdc:mga0yw44_310_c1 nmdc:mga0yw44_310_c1_1770_2480 231
44 3300005445 Ga0070708_100009383 Ga0070708_1000093836 232
45 3300005445 Ga0070708_100213925 Ga0070708_1002139253 232
46 3300005467 Ga0070706_100005067 Ga0070706_1000050675 232
47 3300005467 Ga0070706_100219117 Ga0070706_1002191172 232
48 3300009147 Ga0114129_11117647 Ga0114129_111176471 232
49 3300025910 Ga0207684_10011255 Ga0207684_100112556 232
50 3300025910 Ga0207684_10072770 Ga0207684_100727703 232
51 3300044684 Ga0466966_0018580 Ga0466966_0018580_1390_2121 232
52 3300050507 nmdc:mga05p37_976464_c1 nmdc:mga05p37_976464_c1_77_784 232
53 3300005327 Ga0070658_10002333 Ga0070658_1000233312 233
54 3300005329 Ga0070683_100530532 Ga0070683_1005305322 233
55 3300005445 Ga0070708_100002684 Ga0070708_1000026849 233
56 3300005445 Ga0070708_100006565 Ga0070708_1000065653 233
57 3300005445 Ga0070708_100536590 Ga0070708_1005365902 233
58 3300005459 Ga0068867_100477854 Ga0068867_1004778542 233
59 3300005467 Ga0070706_100093161 Ga0070706_1000931613 233
60 3300005536 Ga0070697_100137608 Ga0070697_1001376083 233
61 3300005563 Ga0068855_100097926 Ga0068855_1000979263 233
62 3300006048 Ga0075363_100004017 Ga0075363_1000040173 233
63 3300006844 Ga0075428_100000246 Ga0075428_10000024645 233
64 3300006847 Ga0075431_100000581 Ga0075431_10000058111 233
65 3300007076 Ga0075435_100064239 Ga0075435_1000642393 233
66 3300009098 Ga0105245_10095112 Ga0105245_100951122 233
67 3300025909 Ga0207705_10002091 Ga0207705_1000209113 233
68 3300025910 Ga0207684_10039660 Ga0207684_100396601 233
69 3300025910 Ga0207684_10513850 Ga0207684_105138502 233
70 3300025912 Ga0207707_10185345 Ga0207707_101853452 233
71 3300025949 Ga0207667_10188981 Ga0207667_101889813 233
72 3300026089 Ga0207648_10470212 Ga0207648_104702121 233
73 3300039438 Ga0436360_0384424 Ga0436360_0384424_984_1700 233
74 3300039447 Ga0436361_0283896 Ga0436361_0283896_2187_2903 233
75 3300039453 Ga0436362_1173420 Ga0436362_1173420_818_1552 233
76 3300044658 Ga0466972_0167702 Ga0466972_0167702_199_918 233
77 3300044693 Ga0466961_0054864 Ga0466961_0054864_1593_2312 233
78 3300046684 Ga0495669_0003938 Ga0495669_0003938_2558_3277 233
79 3300047319 Ga0495674_0221199 Ga0495674_0221199_236_976 233
80 3300047321 Ga0495676_0387734 Ga0495676_0387734_79_819 233
81 3300048907 Ga0496104_0263552 Ga0496104_0263552_559_1296 233
82 3300048918 Ga0496115_0073344 Ga0496115_0073344_1759_2493 233
83 3300050490 nmdc:mga03n38_3368_c1 nmdc:mga03n38_3368_c1_2434_3153 233
84 3300050509 nmdc:mga0qj67_317658_c1 nmdc:mga0qj67_317658_c1_494_1198 233
85 3300050510 nmdc:mga06r32_2244_c1 nmdc:mga06r32_2244_c1_9562_10266 233
86 3300050513 nmdc:mga0rr50_112406_c1 nmdc:mga0rr50_112406_c1_114_833 233
87 3300061734 Ga0530510_0331383 Ga0530510_0331383_327_1067 233
88 3300001979 JGI24740J21852_10002752 JGI24740J21852_100027522 234
89 3300002705 JGI25156J39149_1016025 JGI25156J39149_10160252 234
90 3300002738 JGI25154J39366_1000972 JGI25154J39366_10009722 234
91 3300003756 Ga0055533_1001219 Ga0055533_10012192 234
92 3300003762 Ga0055542_1003782 Ga0055542_10037824 234
93 3300003841 Ga0055541_1000505 Ga0055541_10005052 234
94 3300005445 Ga0070708_100000344 Ga0070708_10000034418 234
95 3300005445 Ga0070708_100171103 Ga0070708_1001711032 234
96 3300005458 Ga0070681_10015948 Ga0070681_100159482 234
97 3300005458 Ga0070681_10017722 Ga0070681_100177223 234
98 3300005458 Ga0070681_10133264 Ga0070681_101332642 234
99 3300005467 Ga0070706_100099552 Ga0070706_1000995522 234
100 3300005518 Ga0070699_100016436 Ga0070699_1000164364 234
101 3300005535 Ga0070684_100143813 Ga0070684_1001438132 234
102 3300005546 Ga0070696_100214245 Ga0070696_1002142452 234
103 3300005563 Ga0068855_100213573 Ga0068855_1002135732 234
104 3300005563 Ga0068855_100252168 Ga0068855_1002521682 234
105 3300005985 Ga0081539_10001863 Ga0081539_100018639 234
106 3300006058 Ga0075432_10150771 Ga0075432_101507712 234
107 3300006914 Ga0075436_100002515 Ga0075436_1000025156 234
108 3300009993 Ga0105028_102180 Ga0105028_1021802 234
109 3300013307 Ga0157372_10802130 Ga0157372_108021301 234
110 3300015261 Ga0182006_1033110 Ga0182006_10331102 234
111 3300015262 Ga0182007_10047709 Ga0182007_100477092 234
112 3300025224 Ga0209784_100430 Ga0209784_10043015 234
113 3300025225 Ga0209566_100596 Ga0209566_10059616 234
114 3300025226 Ga0209674_100201 Ga0209674_10020115 234
115 3300025246 Ga0209646_1000035 Ga0209646_1000035108 234
116 3300025250 Ga0209026_1005045 Ga0209026_10050453 234
117 3300025254 Ga0209148_1000077 Ga0209148_100007741 234
118 3300025904 Ga0207647_10058657 Ga0207647_100586572 234
119 3300025910 Ga0207684_10060352 Ga0207684_100603523 234
120 3300025912 Ga0207707_10059223 Ga0207707_100592234 234
121 3300025912 Ga0207707_10120767 Ga0207707_101207672 234
122 3300025921 Ga0207652_10322856 Ga0207652_103228562 234
123 3300025949 Ga0207667_10129688 Ga0207667_101296882 234
124 3300031238 Ga0265332_10070729 Ga0265332_100707292 234
125 3300031247 Ga0265340_10047487 Ga0265340_100474872 234
126 3300031249 Ga0265339_10023673 Ga0265339_100236734 234
127 3300031456 Ga0307513_10207119 Ga0307513_102071192 234
128 3300031456 Ga0307513_10471989 Ga0307513_104719892 234
129 3300031548 Ga0307408_100452273 Ga0307408_1004522732 234
130 3300031711 Ga0265314_10062870 Ga0265314_100628702 234
131 3300032002 Ga0307416_100137907 Ga0307416_1001379073 234
132 3300039453 Ga0436362_1170263 Ga0436362_1170263_573_1286 234
133 3300042435 Ga0439434_0085049 Ga0439434_0085049_111_878 234
134 3300046460 Ga0495638_0206355 Ga0495638_0206355_106_879 234
135 3300046491 Ga0495584_0018795 Ga0495584_0018795_1698_2459 234
136 3300046491 Ga0495584_0164997 Ga0495584_0164997_168_935 234
137 3300048919 Ga0496116_0101023 Ga0496116_0101023_214_918 234
138 3300048920 Ga0496117_0085454 Ga0496117_0085454_61_765 234
139 3300049571 Ga0501034_0170581 Ga0501034_0170581_1139_1879 234
140 3300049579 Ga0501043_0016691 Ga0501043_0016691_4316_5056 234
141 3300049591 Ga0501075_0096691 Ga0501075_0096691_908_1630 234
142 3300049592 Ga0501076_0267892 Ga0501076_0267892_148_870 234
143 3300050514 nmdc:mga08x19_762_c1 nmdc:mga08x19_762_c1_13020_13751 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

39

186

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9518 2 234
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.944 2 234
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9315 2 228
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9236 2 232
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9229 2 219
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9793 1 232 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.967 1 232 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9618 1 234 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9578 1 234 3.40.50.300
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9384 2 219 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0Q8QKN2-F1-model_v4 ABC transporter ATP-binding protein 0.9996 1 234 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A537ZZ86-F1-model_v4 ABC transporter ATP-binding protein 0.9892 2 213 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A3A0F887-F1-model_v4 Branched-chain amino acid ABC transporter ATP-binding protein 0.9884 1 232 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A844SCB0-F1-model_v4 ATP-binding cassette domain-containing protein 0.9879 1 232 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A1Q5S963-F1-model_v4 ABC transporter domain-containing protein 0.9873 1 232 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Feature Viewer

pLDDT pTM Quality
94.08 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map