F188025

General Info

Members Datasets Scaffolds Average Seq Length
143 80 286 147

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100465684|Ga0070705_1004656841
Length 179
Sequence VAEAVGRPVAVDPADSAAEAAVLVAAGQVRAGSQMRTKEFLSKLEHDRIVGAIGEAESKTSGQIRVFIQRGKLNVDPLIAAQKKFHRLGMQKTRERNAVLVFVAPRAHKFAVVGDTAIHEKCGEEFWQRLVEAMRAHFQKEKFNHAIVEAIEEIGKLLATHFPKRSASSNELPDEIAEA

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
61 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
62 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
63 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
64 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
67 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
68 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
69 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
70 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
71 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
72 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
73 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
74 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
75 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
76 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
77 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
78 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
79 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
80 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.59
Rhizosphere 93.71
Stem 0
Stem Tuber 0
Unclassified 34.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100465684 3300005440 Unclassified 952
2 MBSR1b_contig_4516020 2162886012 Unclassified 942
3 CNXas_1000033 3300000545 Bacteria 29027
4 JGI25405J52794_10003935 3300003911 Bacteria 2632
5 Ga0070690_100388986 3300005330 Bacteria 1021
6 Ga0070670_100133562 3300005331 Bacteria 2144
7 Ga0070680_101026449 3300005336 Unclassified 712
8 Ga0070675_100236239 3300005354 Bacteria 1596
9 Ga0070675_100842491 3300005354 Bacteria 839
10 Ga0070671_100107930 3300005355 Bacteria 2338
11 Ga0070673_100022097 3300005364 Bacteria 4626
12 Ga0070667_100033591 3300005367 Bacteria 4289
13 Ga0070709_10406449 3300005434 Unclassified 1018
14 Ga0070714_100072187 3300005435 Bacteria 2987
15 Ga0070713_100245030 3300005436 Bacteria 1633
16 Ga0070711_100062601 3300005439 Unclassified 2594
17 Ga0070708_100062607 3300005445 Bacteria 3328
18 Ga0070708_100148168 3300005445 Unclassified 2181
19 Ga0070708_100234149 3300005445 Bacteria 1723
20 Ga0070708_100276199 3300005445 Bacteria 1581
21 Ga0070708_100429109 3300005445 Unclassified 1246
22 Ga0070708_100535273 3300005445 Bacteria 1105
23 Ga0070678_100256658 3300005456 Unclassified 1468
24 Ga0070685_10241144 3300005466 Unclassified 1193
25 Ga0070706_100013539 3300005467 Bacteria 7542
26 Ga0070706_100077572 3300005467 Bacteria 3075
27 Ga0070706_100106871 3300005467 Bacteria 2603
28 Ga0070706_100218651 3300005467 Unclassified 1778
29 Ga0070706_100395541 3300005467 Bacteria 1286
30 Ga0070706_100547508 3300005467 Bacteria 1076
31 Ga0070706_100759666 3300005467 Bacteria 898
32 Ga0070706_100804709 3300005467 Bacteria 870
33 Ga0070706_102027175 3300005467 Unclassified 521
34 Ga0070707_100001068 3300005468 Bacteria 27038
35 Ga0070707_100008277 3300005468 Bacteria 9651
36 Ga0070707_100017162 3300005468 Bacteria 6802
37 Ga0070707_100036747 3300005468 Unclassified 4674
38 Ga0070707_100036956 3300005468 Bacteria 4660
39 Ga0070707_100285786 3300005468 Bacteria 1603
40 Ga0070707_100346950 3300005468 Bacteria 1442
41 Ga0070707_100378725 3300005468 Unclassified 1375
42 Ga0070707_100462189 3300005468 Bacteria 1230
43 Ga0070698_100007605 3300005471 Bacteria 11725
44 Ga0070698_100009403 3300005471 Bacteria 10475
45 Ga0070698_100036920 3300005471 Bacteria 5041
46 Ga0070699_100025135 3300005518 Bacteria 5135
47 Ga0070699_100082180 3300005518 Bacteria 2808
48 Ga0070699_100255472 3300005518 Bacteria 1567
49 Ga0070699_100278619 3300005518 Bacteria 1498
50 Ga0070699_100281589 3300005518 Bacteria 1489
51 Ga0070699_100358993 3300005518 Unclassified 1313
52 Ga0070697_100023988 3300005536 Bacteria 4854
53 Ga0070697_100029025 3300005536 Bacteria 4433
54 Ga0070697_100075514 3300005536 Unclassified 2771
55 Ga0070697_100123010 3300005536 Bacteria 2171
56 Ga0070697_100138433 3300005536 Bacteria 2046
57 Ga0070697_100186680 3300005536 Bacteria 1758
58 Ga0070697_100199691 3300005536 Bacteria 1700
59 Ga0070697_100237909 3300005536 Unclassified 1554
60 Ga0070697_102135425 3300005536 Unclassified 501
61 Ga0070672_100704516 3300005543 Unclassified 884
62 Ga0070686_101445506 3300005544 Unclassified 578
63 Ga0070695_100391755 3300005545 Unclassified 1051
64 Ga0070665_100019572 3300005548 Bacteria 6794
65 Ga0070665_100096338 3300005548 Bacteria 2964
66 Ga0081455_10000781 3300005937 Bacteria 40919
67 Ga0081455_10001020 3300005937 Bacteria 35311
68 Ga0081455_10506958 3300005937 Bacteria 809
69 Ga0081540_1000031 3300005983 Bacteria 147094
70 Ga0081539_10006917 3300005985 Bacteria 10565
71 Ga0081539_10084669 3300005985 Bacteria 1656
72 Ga0070717_10144969 3300006028 Unclassified 2051
73 Ga0070717_10819116 3300006028 Unclassified 847
74 Ga0070715_10235140 3300006163 Unclassified 950
75 Ga0070716_100877969 3300006173 Bacteria 700
76 Ga0070712_100060558 3300006175 Unclassified 2670
77 Ga0070712_100108975 3300006175 Unclassified 2063
78 Ga0070712_100234201 3300006175 Bacteria 1460
79 Ga0070712_100355753 3300006175 Unclassified 1199
80 Ga0097621_100375990 3300006237 Bacteria 1268
81 Ga0068871_100009371 3300006358 Bacteria 7089
82 Ga0075436_100050789 3300006914 Unclassified 2862
83 Ga0075436_100800739 3300006914 Unclassified 702
84 Ga0105247_10414395 3300009101 Unclassified 963
85 Ga0114129_10005254 3300009147 Bacteria 18255
86 Ga0105249_10409817 3300009553 Bacteria 1387
87 Ga0157374_10203573 3300013296 Bacteria 1939
88 Ga0157374_11165402 3300013296 Unclassified 792
89 Ga0157378_10209115 3300013297 Bacteria 1849
90 Ga0157378_10733434 3300013297 Unclassified 1010
91 Ga0157378_10751588 3300013297 Unclassified 998
92 Ga0157378_10765711 3300013297 Unclassified 989
93 Ga0163162_10210729 3300013306 Bacteria 2073
94 Ga0157375_10002708 3300013308 Bacteria 15322
95 Ga0207697_10058683 3300025315 Bacteria 1598
96 Ga0207680_10077250 3300025903 Bacteria 2082
97 Ga0207699_10664119 3300025906 Unclassified 762
98 Ga0207684_10030393 3300025910 Unclassified 4598
99 Ga0207684_10240780 3300025910 Bacteria 1561
100 Ga0207684_10271488 3300025910 Unclassified 1463
101 Ga0207684_10601883 3300025910 Unclassified 939
102 Ga0207684_11578704 3300025910 Unclassified 532
103 Ga0207693_10174242 3300025915 Bacteria 1693
104 Ga0207693_10249857 3300025915 Bacteria 1392
105 Ga0207693_10967396 3300025915 Bacteria 651
106 Ga0207663_10013520 3300025916 Bacteria 4439
107 Ga0207646_10000183 3300025922 Bacteria 85731
108 Ga0207646_10032507 3300025922 Bacteria 4722
109 Ga0207646_10061752 3300025922 Unclassified 3345
110 Ga0207646_10083432 3300025922 Unclassified 2859
111 Ga0207646_10625768 3300025922 Unclassified 965
112 Ga0207659_10121279 3300025926 Bacteria 2004
113 Ga0207659_10603676 3300025926 Bacteria 936
114 Ga0207700_10376936 3300025928 Unclassified 1240
115 Ga0207644_11062336 3300025931 Unclassified 680
116 Ga0207691_10111140 3300025940 Bacteria 2437
117 Ga0207651_10024254 3300025960 Bacteria 3748
118 Ga0207658_10025427 3300025986 Bacteria 4146
119 Ga0268266_10058697 3300028379 Bacteria 3313
120 Ga0268265_12095567 3300028380 Unclassified 573
121 Ga0307513_10010986 3300031456 Bacteria 11297
122 Ga0373935_0041727 3300035692 Bacteria 2883
123 Ga0373927_0240412 3300035695 Unclassified 1190
124 Ga0373947_0136915 3300035725 Bacteria 1568
125 Ga0373925_0062054 3300037068 Bacteria 2810
126 Ga0395901_1282140 3300038443 Bacteria 695
127 Ga0451802_0806947 3300041460 Unclassified 750
128 Ga0453684_0098710 3300044712 Bacteria 3579
129 Ga0451576_0043466 3300045051 Bacteria 4741
130 Ga0451576_0225884 3300045051 Bacteria 1955
131 Ga0495630_0563898 3300046517 Bacteria 873
132 Ga0495670_0075322 3300046691 Unclassified 1713
133 Ga0495636_0000312 3300047318 Bacteria 18829
134 Ga0496104_0168848 3300048907 Bacteria 2098
135 Ga0496108_0056529 3300048911 Bacteria 3297
136 Ga0496110_0601943 3300048913 Bacteria 997
137 Ga0496111_1116110 3300048914 Unclassified 561
138 Ga0496112_0454811 3300048915 Bacteria 1218
139 Ga0496114_0628957 3300048917 Unclassified 945
140 Ga0496115_0015831 3300048918 Bacteria 5728
141 nmdc:mga05p37_5366_c1 3300050507 Bacteria 15074
142 nmdc:mga08x19_457920_c1 3300050514 Unclassified 898
143 nmdc:mga08x19_97447_c1 3300050514 Bacteria 1947
144 Ga0070705_100465684
145 MBSR1b_contig_4516020
146 CNXas_1000033
147 JGI25405J52794_10003935
148 Ga0070690_100388986
149 Ga0070670_100133562
150 Ga0070680_101026449
151 Ga0070675_100236239
152 Ga0070675_100842491
153 Ga0070671_100107930
154 Ga0070673_100022097
155 Ga0070667_100033591
156 Ga0070709_10406449
157 Ga0070714_100072187
158 Ga0070713_100245030
159 Ga0070711_100062601
160 Ga0070708_100062607
161 Ga0070708_100148168
162 Ga0070708_100234149
163 Ga0070708_100276199
164 Ga0070708_100429109
165 Ga0070708_100535273
166 Ga0070678_100256658
167 Ga0070685_10241144
168 Ga0070706_100013539
169 Ga0070706_100077572
170 Ga0070706_100106871
171 Ga0070706_100218651
172 Ga0070706_100395541
173 Ga0070706_100547508
174 Ga0070706_100759666
175 Ga0070706_100804709
176 Ga0070706_102027175
177 Ga0070707_100001068
178 Ga0070707_100008277
179 Ga0070707_100017162
180 Ga0070707_100036747
181 Ga0070707_100036956
182 Ga0070707_100285786
183 Ga0070707_100346950
184 Ga0070707_100378725
185 Ga0070707_100462189
186 Ga0070698_100007605
187 Ga0070698_100009403
188 Ga0070698_100036920
189 Ga0070699_100025135
190 Ga0070699_100082180
191 Ga0070699_100255472
192 Ga0070699_100278619
193 Ga0070699_100281589
194 Ga0070699_100358993
195 Ga0070697_100023988
196 Ga0070697_100029025
197 Ga0070697_100075514
198 Ga0070697_100123010
199 Ga0070697_100138433
200 Ga0070697_100186680
201 Ga0070697_100199691
202 Ga0070697_100237909
203 Ga0070697_102135425
204 Ga0070672_100704516
205 Ga0070686_101445506
206 Ga0070695_100391755
207 Ga0070665_100019572
208 Ga0070665_100096338
209 Ga0081455_10000781
210 Ga0081455_10001020
211 Ga0081455_10506958
212 Ga0081540_1000031
213 Ga0081539_10006917
214 Ga0081539_10084669
215 Ga0070717_10144969
216 Ga0070717_10819116
217 Ga0070715_10235140
218 Ga0070716_100877969
219 Ga0070712_100060558
220 Ga0070712_100108975
221 Ga0070712_100234201
222 Ga0070712_100355753
223 Ga0097621_100375990
224 Ga0068871_100009371
225 Ga0075436_100050789
226 Ga0075436_100800739
227 Ga0105247_10414395
228 Ga0114129_10005254
229 Ga0105249_10409817
230 Ga0157374_10203573
231 Ga0157374_11165402
232 Ga0157378_10209115
233 Ga0157378_10733434
234 Ga0157378_10751588
235 Ga0157378_10765711
236 Ga0163162_10210729
237 Ga0157375_10002708
238 Ga0207697_10058683
239 Ga0207680_10077250
240 Ga0207699_10664119
241 Ga0207684_10030393
242 Ga0207684_10240780
243 Ga0207684_10271488
244 Ga0207684_10601883
245 Ga0207684_11578704
246 Ga0207693_10174242
247 Ga0207693_10249857
248 Ga0207693_10967396
249 Ga0207663_10013520
250 Ga0207646_10000183
251 Ga0207646_10032507
252 Ga0207646_10061752
253 Ga0207646_10083432
254 Ga0207646_10625768
255 Ga0207659_10121279
256 Ga0207659_10603676
257 Ga0207700_10376936
258 Ga0207644_11062336
259 Ga0207691_10111140
260 Ga0207651_10024254
261 Ga0207658_10025427
262 Ga0268266_10058697
263 Ga0268265_12095567
264 Ga0307513_10010986
265 Ga0373935_0041727
266 Ga0373927_0240412
267 Ga0373947_0136915
268 Ga0373925_0062054
269 Ga0395901_1282140
270 Ga0451802_0806947
271 Ga0453684_0098710
272 Ga0451576_0043466
273 Ga0451576_0225884
274 Ga0495630_0563898
275 Ga0495670_0075322
276 Ga0495636_0000312
277 Ga0496104_0168848
278 Ga0496108_0056529
279 Ga0496110_0601943
280 Ga0496111_1116110
281 Ga0496112_0454811
282 Ga0496114_0628957
283 Ga0496115_0015831
284 nmdc:mga05p37_5366_c1
285 nmdc:mga08x19_457920_c1
286 nmdc:mga08x19_97447_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04536

TPM_phosphatase

TPM domain

35

157

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lt2-assembly1.cif.gz_A nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov. 0.9366 11 144
2lt2-assembly1.cif.gz_A nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov. 0.8688 11 144
2kpt-assembly1.cif.gz_A solution nmr structure of the n-terminal domain of cg2496 protein from corynebacterium glutamicum. northeast structural genomics consortium target cgr26a 0.8582 11 121
5anp-assembly1.cif.gz_A crystal structure of the ba41 protein from bizionia argentinensis 0.8382 17 127
5anp-assembly2.cif.gz_B crystal structure of the ba41 protein from bizionia argentinensis 0.8311 10 127
ID Description Score Start End Superfamily
2lt2A00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.9366 11 144 3.10.310.50
2lt2A00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8688 11 144 3.10.310.50
2kptA00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8582 11 121 3.10.310.50
5anpB00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8311 10 127 3.10.310.50
af_P9WFJ5_23_159_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8231 11 120 3.10.310.50
ID Description Score Start End GO Terms
AF-A0A0R2SU00-F1-model_v4 deleted 0.9743 11 144
AF-A0A321LSB4-F1-model_v4 TPM domain-containing protein 0.9699 13 144 GO:0016020
AF-E0RU68-F1-model_v4 Putative long-chain-fatty-acid-CoA ligase 0.9693 44 141 GO:0016020
GO:0016874
AF-A0A1G9EFS9-F1-model_v4 TLP18.3, Psb32 and MOLO-1 founding protein of phosphatase 0.9684 11 144 GO:0016020
AF-A0A7X7USJ5-F1-model_v4 TPM domain-containing protein 0.9681 11 144 GO:0016020

Map