F186586

General Info

Members Datasets Scaffolds Average Seq Length
142 86 284 294

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0004043|Ga0453684_0004043_14558_15514
Length 318
Sequence LQIRIRAIVHAAVARLLPRKEQPMTTVVLSTDFPDLSLAGRGKVRDMYDLGDALLIVTTDRISAFDVIMNEGIPGKGEVLTQISAHWFRRMEGILANHLITTDVREFPAVCRPYADLLAGRSMLVKKARPLPAECIVRGFLAGSGWKEYRSTGCVCGIRLPEGLVESQRLEEPIFTPSTKAELGAHDENITFERMAELCGADLAEQACQATLAIYRAARDYADSRGILIADTKFEFGVHDGQLILIDECLTPDSSRFWPKDAYRPGTAPPSFDKQYLRDYLETLDWNKKVPAPPLPGEIVQRTAEKYREAMELLFGAP

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
63 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
64 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
65 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
70 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
71 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
72 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
73 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
74 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
75 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
76 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
79 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
82 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
83 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
84 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
85 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
86 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.59
Stem 0
Stem Tuber 0
Unclassified 4.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0004043 3300044712 Bacteria 31888
2 Ga0065704_10098096 3300005289 Unclassified 2366
3 Ga0065707_10084918 3300005295 Bacteria 6637
4 Ga0065707_10091624 3300005295 Bacteria 3906
5 Ga0070683_100080606 3300005329 Bacteria 3047
6 Ga0070690_100249467 3300005330 Bacteria 1255
7 Ga0070680_100240162 3300005336 Unclassified 1531
8 Ga0070689_100209403 3300005340 Bacteria 1595
9 Ga0070692_10039163 3300005345 Bacteria 2419
10 Ga0070668_100008711 3300005347 Bacteria 7534
11 Ga0070669_100089156 3300005353 Bacteria 2310
12 Ga0070709_10000012 3300005434 Bacteria 163026
13 Ga0070714_100139033 3300005435 Bacteria 2178
14 Ga0070705_100158259 3300005440 Bacteria 1511
15 Ga0070700_100128677 3300005441 Bacteria 1706
16 Ga0070708_100409556 3300005445 Bacteria 1279
17 Ga0068867_100258178 3300005459 Bacteria 1420
18 Ga0070706_100120036 3300005467 Bacteria 2450
19 Ga0070707_100142992 3300005468 Bacteria 2328
20 Ga0070698_100004001 3300005471 Bacteria 16220
21 Ga0070699_100131892 3300005518 Bacteria 2202
22 Ga0070684_100156687 3300005535 Bacteria 2065
23 Ga0070697_100001763 3300005536 Bacteria 16519
24 Ga0070697_100024850 3300005536 Bacteria 4771
25 Ga0070704_100048278 3300005549 Bacteria 2979
26 Ga0070704_100122361 3300005549 Bacteria 2002
27 Ga0068861_100159776 3300005719 Unclassified 1858
28 Ga0068858_100330584 3300005842 Bacteria 1458
29 Ga0068860_100000384 3300005843 Bacteria 57893
30 Ga0068862_100015309 3300005844 Bacteria 6370
31 Ga0081540_1045239 3300005983 Bacteria 2238
32 Ga0070717_10029690 3300006028 Bacteria 4389
33 Ga0070717_10174368 3300006028 Bacteria 1872
34 Ga0070716_100071349 3300006173 Bacteria 2041
35 Ga0075428_100005199 3300006844 Bacteria 14459
36 Ga0075434_100018888 3300006871 Bacteria 6663
37 Ga0075429_100114345 3300006880 Bacteria 2359
38 Ga0068865_100000805 3300006881 Bacteria 17622
39 Ga0075436_100000395 3300006914 Bacteria 28036
40 Ga0075436_100078678 3300006914 Bacteria 2284
41 Ga0075435_100314899 3300007076 Bacteria 1339
42 Ga0105240_10047314 3300009093 Bacteria 5444
43 Ga0111539_10591680 3300009094 Bacteria 1292
44 Ga0105245_10314100 3300009098 Bacteria 1542
45 Ga0114129_10013446 3300009147 Bacteria 11664
46 Ga0105249_10002547 3300009553 Bacteria 15780
47 Ga0163162_10019911 3300013306 Bacteria 6590
48 Ga0157375_10034290 3300013308 Bacteria 4835
49 Ga0157380_10012286 3300014326 Bacteria 6207
50 Ga0157379_10069755 3300014968 Bacteria 3144
51 Ga0224712_10085378 3300022467 Bacteria 1311
52 Ga0207699_10000087 3300025906 Bacteria 69697
53 Ga0207695_10047438 3300025913 Bacteria 4546
54 Ga0207660_10225173 3300025917 Unclassified 1473
55 Ga0207646_10034753 3300025922 Bacteria 4556
56 Ga0207646_10145295 3300025922 Bacteria 2137
57 Ga0207687_10300890 3300025927 Bacteria 1292
58 Ga0207700_10123222 3300025928 Bacteria 2105
59 Ga0207664_10242578 3300025929 Bacteria 1570
60 Ga0207670_10013023 3300025936 Bacteria 4890
61 Ga0207665_10011801 3300025939 Bacteria 5742
62 Ga0207658_10151320 3300025986 Bacteria 1891
63 Ga0207703_10270992 3300026035 Bacteria 1538
64 Ga0207641_10021820 3300026088 Bacteria 5265
65 Ga0207648_10002271 3300026089 Bacteria 20796
66 Ga0207428_10200480 3300027907 Unclassified 1502
67 Ga0268264_10001034 3300028381 Bacteria 27952
68 Ga0265326_10003000 3300028558 Bacteria 5613
69 Ga0265319_1003051 3300028563 Bacteria 8867
70 Ga0265318_10000313 3300028577 Bacteria 38864
71 Ga0265336_10007167 3300028666 Bacteria 3979
72 Ga0265338_10046220 3300028800 Bacteria 3991
73 Ga0265338_10049156 3300028800 Bacteria 3826
74 Ga0265340_10011343 3300031247 Bacteria 4738
75 Ga0265340_10033828 3300031247 Bacteria 2543
76 Ga0265327_10003382 3300031251 Bacteria 15344
77 Ga0316579_10017295 3300031691 Bacteria 3160
78 Ga0373951_0000899 3300035091 Bacteria 8013
79 Ga0316582_0027962 3300036647 Unclassified 3412
80 Ga0316584_0042019 3300036712 Bacteria 3409
81 Ga0436364_1558185 3300037853 Bacteria 1487
82 Ga0436365_1475218 3300039437 Bacteria 1064
83 Ga0451577_0000035 3300042876 Bacteria 373467
84 Ga0451577_0000070 3300042876 Bacteria 238621
85 Ga0451577_0025714 3300042876 Bacteria 5340
86 Ga0451577_0030949 3300042876 Bacteria 4832
87 Ga0451577_0062379 3300042876 Bacteria 3324
88 Ga0451577_0085595 3300042876 Bacteria 2813
89 Ga0451577_0218422 3300042876 Bacteria 1723
90 Ga0451577_0271722 3300042876 Bacteria 1535
91 Ga0453683_0000020 3300044673 Bacteria 286813
92 Ga0453683_0000050 3300044673 Bacteria 202054
93 Ga0453683_0000555 3300044673 Bacteria 41398
94 Ga0453683_0014155 3300044673 Bacteria 5184
95 Ga0453683_0021271 3300044673 Bacteria 4142
96 Ga0453683_0034435 3300044673 Bacteria 3193
97 Ga0453683_0043366 3300044673 Bacteria 2823
98 Ga0453683_0049308 3300044673 Bacteria 2640
99 Ga0453684_0000097 3300044712 Bacteria 377772
100 Ga0453684_0000233 3300044712 Bacteria 240186
101 Ga0453684_0000383 3300044712 Bacteria 181393
102 Ga0453684_0000436 3300044712 Bacteria 170125
103 Ga0453684_0002393 3300044712 Bacteria 45725
104 Ga0453684_0003817 3300044712 Bacteria 33232
105 Ga0453684_0004399 3300044712 Bacteria 29811
106 Ga0453684_0005282 3300044712 Bacteria 25787
107 Ga0453684_0008394 3300044712 Bacteria 18532
108 Ga0453684_0010207 3300044712 Bacteria 16106
109 Ga0453684_0014325 3300044712 Bacteria 12702
110 Ga0453684_0016453 3300044712 Bacteria 11563
111 Ga0453684_0018208 3300044712 Bacteria 10805
112 Ga0453684_0044408 3300044712 Bacteria 5947
113 Ga0453684_0047893 3300044712 Bacteria 5661
114 Ga0453684_0126478 3300044712 Bacteria 3075
115 Ga0453684_0129394 3300044712 Bacteria 3031
116 Ga0453684_0179498 3300044712 Bacteria 2486
117 Ga0453684_0268853 3300044712 Bacteria 1949
118 Ga0453684_0310479 3300044712 Bacteria 1789
119 Ga0453684_0384463 3300044712 Bacteria 1575
120 Ga0453684_0644458 3300044712 Bacteria 1157
121 Ga0453684_0645372 3300044712 Bacteria 1156
122 Ga0451576_0000049 3300045051 Bacteria 323945
123 Ga0451576_0001566 3300045051 Bacteria 38485
124 Ga0451576_0001588 3300045051 Bacteria 38190
125 Ga0451576_0007726 3300045051 Bacteria 12777
126 Ga0451576_0009922 3300045051 Bacteria 10995
127 Ga0451576_0054762 3300045051 Bacteria 4175
128 Ga0451576_0057462 3300045051 Bacteria 4067
129 Ga0451576_0159728 3300045051 Bacteria 2352
130 Ga0451576_0301973 3300045051 Bacteria 1675
131 Ga0451576_0410508 3300045051 Bacteria 1420
132 Ga0495602_0049513 3300048088 Bacteria 3763
133 Ga0501034_0073959 3300049571 Bacteria 3416
134 Ga0501037_0196200 3300049573 Bacteria 1428
135 Ga0501070_0097167 3300049586 Bacteria 2436
136 nmdc:mga05p37_166_c1 3300050507 Bacteria 63976
137 nmdc:mga08y16_79487_c1 3300050511 Bacteria 3418
138 nmdc:mga0n895_28836_c1 3300050512 Bacteria 5285
139 nmdc:mga0rr50_26192_c1 3300050513 Bacteria 4064
140 nmdc:mga0rr50_307914_c1 3300050513 Bacteria 1326
141 nmdc:mga08x19_10_c1 3300050514 Bacteria 404490
142 nmdc:mga08x19_35632_c1 3300050514 Bacteria 3149
143 Ga0453684_0004043
144 Ga0065704_10098096
145 Ga0065707_10084918
146 Ga0065707_10091624
147 Ga0070683_100080606
148 Ga0070690_100249467
149 Ga0070680_100240162
150 Ga0070689_100209403
151 Ga0070692_10039163
152 Ga0070668_100008711
153 Ga0070669_100089156
154 Ga0070709_10000012
155 Ga0070714_100139033
156 Ga0070705_100158259
157 Ga0070700_100128677
158 Ga0070708_100409556
159 Ga0068867_100258178
160 Ga0070706_100120036
161 Ga0070707_100142992
162 Ga0070698_100004001
163 Ga0070699_100131892
164 Ga0070684_100156687
165 Ga0070697_100001763
166 Ga0070697_100024850
167 Ga0070704_100048278
168 Ga0070704_100122361
169 Ga0068861_100159776
170 Ga0068858_100330584
171 Ga0068860_100000384
172 Ga0068862_100015309
173 Ga0081540_1045239
174 Ga0070717_10029690
175 Ga0070717_10174368
176 Ga0070716_100071349
177 Ga0075428_100005199
178 Ga0075434_100018888
179 Ga0075429_100114345
180 Ga0068865_100000805
181 Ga0075436_100000395
182 Ga0075436_100078678
183 Ga0075435_100314899
184 Ga0105240_10047314
185 Ga0111539_10591680
186 Ga0105245_10314100
187 Ga0114129_10013446
188 Ga0105249_10002547
189 Ga0163162_10019911
190 Ga0157375_10034290
191 Ga0157380_10012286
192 Ga0157379_10069755
193 Ga0224712_10085378
194 Ga0207699_10000087
195 Ga0207695_10047438
196 Ga0207660_10225173
197 Ga0207646_10034753
198 Ga0207646_10145295
199 Ga0207687_10300890
200 Ga0207700_10123222
201 Ga0207664_10242578
202 Ga0207670_10013023
203 Ga0207665_10011801
204 Ga0207658_10151320
205 Ga0207703_10270992
206 Ga0207641_10021820
207 Ga0207648_10002271
208 Ga0207428_10200480
209 Ga0268264_10001034
210 Ga0265326_10003000
211 Ga0265319_1003051
212 Ga0265318_10000313
213 Ga0265336_10007167
214 Ga0265338_10046220
215 Ga0265338_10049156
216 Ga0265340_10011343
217 Ga0265340_10033828
218 Ga0265327_10003382
219 Ga0316579_10017295
220 Ga0373951_0000899
221 Ga0316582_0027962
222 Ga0316584_0042019
223 Ga0436364_1558185
224 Ga0436365_1475218
225 Ga0451577_0000035
226 Ga0451577_0000070
227 Ga0451577_0025714
228 Ga0451577_0030949
229 Ga0451577_0062379
230 Ga0451577_0085595
231 Ga0451577_0218422
232 Ga0451577_0271722
233 Ga0453683_0000020
234 Ga0453683_0000050
235 Ga0453683_0000555
236 Ga0453683_0014155
237 Ga0453683_0021271
238 Ga0453683_0034435
239 Ga0453683_0043366
240 Ga0453683_0049308
241 Ga0453684_0000097
242 Ga0453684_0000233
243 Ga0453684_0000383
244 Ga0453684_0000436
245 Ga0453684_0002393
246 Ga0453684_0003817
247 Ga0453684_0004399
248 Ga0453684_0005282
249 Ga0453684_0008394
250 Ga0453684_0010207
251 Ga0453684_0014325
252 Ga0453684_0016453
253 Ga0453684_0018208
254 Ga0453684_0044408
255 Ga0453684_0047893
256 Ga0453684_0126478
257 Ga0453684_0129394
258 Ga0453684_0179498
259 Ga0453684_0268853
260 Ga0453684_0310479
261 Ga0453684_0384463
262 Ga0453684_0644458
263 Ga0453684_0645372
264 Ga0451576_0000049
265 Ga0451576_0001566
266 Ga0451576_0001588
267 Ga0451576_0007726
268 Ga0451576_0009922
269 Ga0451576_0054762
270 Ga0451576_0057462
271 Ga0451576_0159728
272 Ga0451576_0301973
273 Ga0451576_0410508
274 Ga0495602_0049513
275 Ga0501034_0073959
276 Ga0501037_0196200
277 Ga0501070_0097167
278 nmdc:mga05p37_166_c1
279 nmdc:mga08y16_79487_c1
280 nmdc:mga0n895_28836_c1
281 nmdc:mga0rr50_26192_c1
282 nmdc:mga0rr50_307914_c1
283 nmdc:mga08x19_10_c1
284 nmdc:mga08x19_35632_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01259

SAICAR_synt

SAICAR synthetase

38

293

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cnq-assembly1.cif.gz_A atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with adp, aicar, succinate 0.9471 7 295
1obd-assembly1.cif.gz_A saicar-synthase complexed with atp 0.9273 5 296
2cnq-assembly1.cif.gz_A atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with adp, aicar, succinate 0.9222 7 295
1obg-assembly1.cif.gz_A saicar-synthase complexed with atp 0.9219 3 296
2cnv-assembly1.cif.gz_A saicar-synthase from saccharomyces cerevisiae complexed saicar 0.9181 7 296
ID Description Score Start End Superfamily
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9826 106 248 3.30.470.20
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9627 106 248 3.30.470.20
1obgA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9571 106 248 3.30.470.20
af_P38025_185_330_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9395 108 241 3.30.470.20
af_P38025_96_184_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9378 11 106 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A3S4W3U4-F1-model_v4 deleted 0.996 103 210
AF-A0A7Z9Y8X1-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9953 3 102 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A3C1BV40-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9947 3 247 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-X0V669-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9944 1 148 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-X0TZU3-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9941 2 91 GO:0004639
GO:0005524
GO:0005737
GO:0006189

Map