F186520

General Info

Members Datasets Scaffolds Average Seq Length
142 49 284 235

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0020038|Ga0451577_0020038_2907_3617
Length 236
Sequence MNPFLATLLTFAIAIGWLRLMDFFAHKGWIESRLSRKIIHIGTGPIFVLCWLLFPVAPGNWYDRWLAALVPGLITVQFALVGLGIVKDEASVQAMSRSGDRREILRGPLFYGIAFVALTLIYWKDSPIGMTALMLMCGGDGIADLVGRAVKSPKLPWSPRKSVAGSLAVFLGGFILSAAILAVFIAAGVFMLSFAGTLLPLLIIALAGTLVESLPFEDIDNLTVCIVAALLGHLLF

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
31 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
32 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
33 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
34 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
35 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
36 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
37 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
38 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
39 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
40 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
41 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
42 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
43 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
44 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
45 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
46 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
47 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
48 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
49 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 26.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0020038 3300042876 Bacteria 6142
2 SwRhRL2b_contig_3564812 2162886007 Bacteria 4074
3 SwRhRL2b_contig_553259 2162886007 Bacteria 4285
4 JGI25406J46586_10023141 3300003203 Unclassified 2459
5 Ga0065712_10329470 3300005290 Unclassified 816
6 Ga0065707_10000776 3300005295 Bacteria 19728
7 Ga0065707_10009761 3300005295 Bacteria 2592
8 Ga0065707_10084221 3300005295 Bacteria 7503
9 Ga0068869_100191607 3300005334 Bacteria 1608
10 Ga0070689_100290846 3300005340 Unclassified 1358
11 Ga0070673_100218125 3300005364 Bacteria 1650
12 Ga0070694_100329623 3300005444 Bacteria 1177
13 Ga0070698_100028804 3300005471 Bacteria 5764
14 Ga0070698_100141607 3300005471 Bacteria 2356
15 Ga0070698_100307215 3300005471 Unclassified 1517
16 Ga0070698_100539619 3300005471 Unclassified 1105
17 Ga0070699_100108775 3300005518 Bacteria 2433
18 Ga0070699_100538077 3300005518 Unclassified 1063
19 Ga0070697_100559450 3300005536 Unclassified 1003
20 Ga0070704_100090121 3300005549 Bacteria 2283
21 Ga0070704_100135539 3300005549 Unclassified 1915
22 Ga0070704_100200446 3300005549 Unclassified 1611
23 Ga0068859_100253938 3300005617 Unclassified 1849
24 Ga0068861_100044934 3300005719 Bacteria 3324
25 Ga0081539_10005360 3300005985 Bacteria 13138
26 Ga0081539_10005705 3300005985 Bacteria 12468
27 Ga0081539_10006677 3300005985 Bacteria 10902
28 Ga0075428_100167273 3300006844 Bacteria 2385
29 Ga0075428_100376012 3300006844 Bacteria 1523
30 Ga0075430_100027560 3300006846 Bacteria 4826
31 Ga0075430_100236890 3300006846 Unclassified 1513
32 Ga0075430_100325134 3300006846 Unclassified 1271
33 Ga0075431_100027769 3300006847 Bacteria 5808
34 Ga0075431_100034393 3300006847 Bacteria 5220
35 Ga0075431_100325823 3300006847 Bacteria 1548
36 Ga0075431_100537392 3300006847 Bacteria 1157
37 Ga0075431_100746473 3300006847 Unclassified 954
38 Ga0075434_100885543 3300006871 Unclassified 908
39 Ga0075429_100000336 3300006880 Bacteria 34137
40 Ga0075429_100140965 3300006880 Bacteria 2110
41 Ga0075429_100535236 3300006880 Bacteria 1027
42 Ga0097620_100253924 3300006931 Unclassified 1849
43 Ga0111539_10074083 3300009094 Unclassified 4012
44 Ga0114129_10002415 3300009147 Bacteria 25945
45 Ga0114129_10040857 3300009147 Bacteria 6538
46 Ga0114129_10055121 3300009147 Bacteria 5572
47 Ga0114129_10097531 3300009147 Bacteria 4069
48 Ga0114129_10194071 3300009147 Bacteria 2755
49 Ga0114129_10426868 3300009147 Bacteria 1742
50 Ga0114129_10877442 3300009147 Bacteria 1138
51 Ga0105243_10157211 3300009148 Bacteria 1956
52 Ga0105243_10267900 3300009148 Unclassified 1532
53 Ga0105249_10645895 3300009553 Bacteria 1116
54 Ga0105249_10978420 3300009553 Bacteria 914
55 Ga0207712_10469775 3300025961 Bacteria 1070
56 Ga0209981_1017847 3300027378 Bacteria 1003
57 Ga0268265_10088284 3300028380 Unclassified 2470
58 Ga0265338_10387852 3300028800 Bacteria 998
59 Ga0316575_10026487 3300031665 Bacteria 2253
60 Ga0316579_10017446 3300031691 Bacteria 3147
61 Ga0316579_10143998 3300031691 Unclassified 1149
62 Ga0316578_10076239 3300031728 Bacteria 1991
63 Ga0316578_10095548 3300031728 Bacteria 1779
64 Ga0316577_10303079 3300031733 Bacteria 905
65 Ga0316577_10334642 3300031733 Unclassified 859
66 Ga0307407_10239964 3300031903 Bacteria 1236
67 Ga0307407_10517920 3300031903 Bacteria 877
68 Ga0307409_100211324 3300031995 Bacteria 1744
69 Ga0307409_101020466 3300031995 Unclassified 846
70 Ga0316574_0003418 3300035398 Bacteria 8180
71 Ga0316574_0263371 3300035398 Bacteria 1100
72 Ga0316582_0007863 3300036647 Bacteria 5696
73 Ga0316582_0038027 3300036647 Bacteria 2988
74 Ga0316582_0090466 3300036647 Bacteria 2014
75 Ga0316582_0319340 3300036647 Unclassified 1067
76 Ga0316584_0073374 3300036712 Unclassified 2565
77 Ga0316584_0201969 3300036712 Bacteria 1466
78 Ga0316584_0357578 3300036712 Bacteria 1047
79 Ga0451577_0008400 3300042876 Bacteria 10049
80 Ga0451577_0013964 3300042876 Bacteria 7497
81 Ga0451577_0356616 3300042876 Unclassified 1326
82 Ga0451577_0831956 3300042876 Bacteria 833
83 Ga0453683_0000751 3300044673 Bacteria 32744
84 Ga0453683_0067517 3300044673 Bacteria 2235
85 Ga0453683_0114409 3300044673 Unclassified 1697
86 Ga0453683_0294693 3300044673 Unclassified 1037
87 Ga0453683_0314338 3300044673 Unclassified 1003
88 Ga0453684_0000012 3300044712 Bacteria 1062512
89 Ga0453684_0000023 3300044712 Bacteria 857153
90 Ga0453684_0000162 3300044712 Bacteria 298154
91 Ga0453684_0000541 3300044712 Bacteria 143452
92 Ga0453684_0001638 3300044712 Bacteria 60803
93 Ga0453684_0001833 3300044712 Bacteria 55557
94 Ga0453684_0014678 3300044712 Bacteria 12491
95 Ga0453684_0039646 3300044712 Bacteria 6413
96 Ga0453684_0041955 3300044712 Bacteria 6175
97 Ga0453684_0042230 3300044712 Bacteria 6150
98 Ga0453684_0042778 3300044712 Bacteria 6100
99 Ga0453684_0093409 3300044712 Bacteria 3705
100 Ga0453684_0109575 3300044712 Bacteria 3358
101 Ga0453684_0153563 3300044712 Bacteria 2733
102 Ga0453684_0171261 3300044712 Bacteria 2558
103 Ga0453684_0189213 3300044712 Bacteria 2409
104 Ga0453684_0203667 3300044712 Bacteria 2305
105 Ga0453684_0213243 3300044712 Unclassified 2243
106 Ga0453684_0227692 3300044712 Bacteria 2154
107 Ga0453684_0243664 3300044712 Unclassified 2068
108 Ga0453684_0361246 3300044712 Bacteria 1635
109 Ga0453684_0426625 3300044712 Bacteria 1480
110 Ga0453684_0462060 3300044712 Unclassified 1411
111 Ga0453684_0551038 3300044712 Bacteria 1270
112 Ga0453684_0554698 3300044712 Bacteria 1265
113 Ga0453684_0957128 3300044712 Unclassified 913
114 Ga0451576_0000263 3300045051 Bacteria 128339
115 Ga0451576_0002311 3300045051 Bacteria 28877
116 Ga0451576_0006862 3300045051 Bacteria 13804
117 Ga0451576_0044244 3300045051 Bacteria 4694
118 Ga0451576_0044765 3300045051 Bacteria 4662
119 Ga0451576_0379774 3300045051 Unclassified 1481
120 Ga0451576_0622867 3300045051 Bacteria 1134
121 Ga0451576_0934867 3300045051 Unclassified 909
122 Ga0501041_0200260 3300049577 Bacteria 1252
123 Ga0501045_0087852 3300049824 Unclassified 2296
124 Ga0501045_0291666 3300049824 Bacteria 1214
125 nmdc:mga05p37_107125_c1 3300050507 Bacteria 3439
126 nmdc:mga05p37_123095_c1 3300050507 Unclassified 3186
127 nmdc:mga05p37_185278_c1 3300050507 Bacteria 2531
128 nmdc:mga05p37_2179_c1 3300050507 Bacteria 22835
129 nmdc:mga05p37_329326_c1 3300050507 Bacteria 1805
130 nmdc:mga05p37_421170_c1 3300050507 Bacteria 1554
131 nmdc:mga05p37_80806_c1 3300050507 Bacteria 4004
132 nmdc:mga09592_100193_c1 3300050508 Unclassified 2481
133 nmdc:mga09592_119928_c1 3300050508 Bacteria 2259
134 nmdc:mga09592_146941_c1 3300050508 Bacteria 2033
135 nmdc:mga09592_183456_c1 3300050508 Bacteria 1810
136 nmdc:mga09592_187472_c1 3300050508 Bacteria 1790
137 nmdc:mga09592_2652_c1 3300050508 Bacteria 14469
138 nmdc:mga0qj67_208312_c1 3300050509 Unclassified 1588
139 nmdc:mga0qj67_677711_c1 3300050509 Bacteria 821
140 nmdc:mga06r32_122031_c1 3300050510 Bacteria 2571
141 nmdc:mga06r32_517755_c1 3300050510 Bacteria 1169
142 nmdc:mga0a205_237664_c1 3300050515 Bacteria 1703
143 Ga0451577_0020038
144 SwRhRL2b_contig_3564812
145 SwRhRL2b_contig_553259
146 JGI25406J46586_10023141
147 Ga0065712_10329470
148 Ga0065707_10000776
149 Ga0065707_10009761
150 Ga0065707_10084221
151 Ga0068869_100191607
152 Ga0070689_100290846
153 Ga0070673_100218125
154 Ga0070694_100329623
155 Ga0070698_100028804
156 Ga0070698_100141607
157 Ga0070698_100307215
158 Ga0070698_100539619
159 Ga0070699_100108775
160 Ga0070699_100538077
161 Ga0070697_100559450
162 Ga0070704_100090121
163 Ga0070704_100135539
164 Ga0070704_100200446
165 Ga0068859_100253938
166 Ga0068861_100044934
167 Ga0081539_10005360
168 Ga0081539_10005705
169 Ga0081539_10006677
170 Ga0075428_100167273
171 Ga0075428_100376012
172 Ga0075430_100027560
173 Ga0075430_100236890
174 Ga0075430_100325134
175 Ga0075431_100027769
176 Ga0075431_100034393
177 Ga0075431_100325823
178 Ga0075431_100537392
179 Ga0075431_100746473
180 Ga0075434_100885543
181 Ga0075429_100000336
182 Ga0075429_100140965
183 Ga0075429_100535236
184 Ga0097620_100253924
185 Ga0111539_10074083
186 Ga0114129_10002415
187 Ga0114129_10040857
188 Ga0114129_10055121
189 Ga0114129_10097531
190 Ga0114129_10194071
191 Ga0114129_10426868
192 Ga0114129_10877442
193 Ga0105243_10157211
194 Ga0105243_10267900
195 Ga0105249_10645895
196 Ga0105249_10978420
197 Ga0207712_10469775
198 Ga0209981_1017847
199 Ga0268265_10088284
200 Ga0265338_10387852
201 Ga0316575_10026487
202 Ga0316579_10017446
203 Ga0316579_10143998
204 Ga0316578_10076239
205 Ga0316578_10095548
206 Ga0316577_10303079
207 Ga0316577_10334642
208 Ga0307407_10239964
209 Ga0307407_10517920
210 Ga0307409_100211324
211 Ga0307409_101020466
212 Ga0316574_0003418
213 Ga0316574_0263371
214 Ga0316582_0007863
215 Ga0316582_0038027
216 Ga0316582_0090466
217 Ga0316582_0319340
218 Ga0316584_0073374
219 Ga0316584_0201969
220 Ga0316584_0357578
221 Ga0451577_0008400
222 Ga0451577_0013964
223 Ga0451577_0356616
224 Ga0451577_0831956
225 Ga0453683_0000751
226 Ga0453683_0067517
227 Ga0453683_0114409
228 Ga0453683_0294693
229 Ga0453683_0314338
230 Ga0453684_0000012
231 Ga0453684_0000023
232 Ga0453684_0000162
233 Ga0453684_0000541
234 Ga0453684_0001638
235 Ga0453684_0001833
236 Ga0453684_0014678
237 Ga0453684_0039646
238 Ga0453684_0041955
239 Ga0453684_0042230
240 Ga0453684_0042778
241 Ga0453684_0093409
242 Ga0453684_0109575
243 Ga0453684_0153563
244 Ga0453684_0171261
245 Ga0453684_0189213
246 Ga0453684_0203667
247 Ga0453684_0213243
248 Ga0453684_0227692
249 Ga0453684_0243664
250 Ga0453684_0361246
251 Ga0453684_0426625
252 Ga0453684_0462060
253 Ga0453684_0551038
254 Ga0453684_0554698
255 Ga0453684_0957128
256 Ga0451576_0000263
257 Ga0451576_0002311
258 Ga0451576_0006862
259 Ga0451576_0044244
260 Ga0451576_0044765
261 Ga0451576_0379774
262 Ga0451576_0622867
263 Ga0451576_0934867
264 Ga0501041_0200260
265 Ga0501045_0087852
266 Ga0501045_0291666
267 nmdc:mga05p37_107125_c1
268 nmdc:mga05p37_123095_c1
269 nmdc:mga05p37_185278_c1
270 nmdc:mga05p37_2179_c1
271 nmdc:mga05p37_329326_c1
272 nmdc:mga05p37_421170_c1
273 nmdc:mga05p37_80806_c1
274 nmdc:mga09592_100193_c1
275 nmdc:mga09592_119928_c1
276 nmdc:mga09592_146941_c1
277 nmdc:mga09592_183456_c1
278 nmdc:mga09592_187472_c1
279 nmdc:mga09592_2652_c1
280 nmdc:mga0qj67_208312_c1
281 nmdc:mga0qj67_677711_c1
282 nmdc:mga06r32_122031_c1
283 nmdc:mga06r32_517755_c1
284 nmdc:mga0a205_237664_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5guf-assembly1.cif.gz_A-2 structural insight into an intramembrane enzyme for archaeal membrane lipids biosynthesis 0.6263 124 232
5guf-assembly1.cif.gz_A-2 structural insight into an intramembrane enzyme for archaeal membrane lipids biosynthesis 0.455 124 232
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.397 7 233
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.3868 7 233
6m6z-assembly1.cif.gz_D a de novo designed transmembrane nanopore, tmh4c4 0.3847 3 207
ID Description Score Start End Superfamily
af_A0A1D8PJH3_96_584_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.6048 12 231 1.25.10.10
af_A0A1D8PJH3_96_584_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5747 12 231 1.25.10.10
af_A4I1N6_7_128_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3897 106 209 1.20.140.150
af_A4I3S1_470_597_1.20.58.340 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.3626 16 118 1.20.58.340
af_A4I1N6_7_128_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3427 106 209 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A2V0PQS4-F1-model_v4 phytol kinase (EC 2.7.1.182) 0.9693 3 232 GO:0009507
GO:0016020
GO:0016301
AF-A0A388M8T2-F1-model_v4 phytol kinase (EC 2.7.1.182) 0.9693 2 231 GO:0016020
GO:0016301
GO:0046872
AF-A0A2P6VML0-F1-model_v4 Putative phytol kinase chloroplastic 0.969 3 232 GO:0000226
GO:0005524
GO:0016020
GO:0016301
GO:0016887
AF-A0A1D1ZQ62-F1-model_v4 phytol kinase (EC 2.7.1.182) 0.9677 3 231 GO:0009507
GO:0016020
GO:0016301
AF-A0A1Y1HP33-F1-model_v4 phytol kinase (EC 2.7.1.182) 0.9646 3 233 GO:0009507
GO:0016020
GO:0016301

Map