F185319

General Info

Members Datasets Scaffolds Average Seq Length
142 116 284 131

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10008536|Ga0075368_100085364
Length 136
Sequence MVVYAGRAMDTATLFEPLLALLEQLPSMQLPAGRKSIGTGVAADGRWWVKFRLDTADPLAWRVVQELGHVLNLVSIDEPLPTVFKPVSPPPYLNGGVEFLSWVIEATDPRFSPADCANWLRARLPDPVGDRTAWPL

Samples

Sample ID Description Type Environment
1 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
62 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
66 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
67 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
68 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
69 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
73 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
74 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
77 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
78 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
79 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
80 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
81 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
82 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
83 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
84 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
85 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
86 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
87 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
88 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
89 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
90 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
91 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
92 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
93 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
94 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
95 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
96 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
97 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
106 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
107 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
108 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
109 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
110 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
113 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
114 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
115 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
116 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.97
Nodule 0
Rhizoplane 0.7
Rhizosphere 82.39
Stem 0
Stem Tuber 0
Unclassified 21.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075368_10008536 3300006042 Bacteria 3652
2 rootH1_10007553 3300003316 Bacteria 4621
3 rootH2_10085607 3300003320 Bacteria 7471
4 rootL2_10112634 3300003322 Bacteria 4979
5 rootL2_10314753 3300003322 Unclassified 3962
6 Ga0065712_10235727 3300005290 Bacteria 998
7 Ga0070682_100006472 3300005337 Bacteria 6584
8 Ga0070660_100741745 3300005339 Bacteria 824
9 Ga0070709_10307389 3300005434 Bacteria 1160
10 Ga0070714_100124221 3300005435 Bacteria 2299
11 Ga0070714_100799021 3300005435 Bacteria 914
12 Ga0070681_10270419 3300005458 Unclassified 1611
13 Ga0070681_10454107 3300005458 Bacteria 1194
14 Ga0070685_10154687 3300005466 Unclassified 1456
15 Ga0070679_100270560 3300005530 Bacteria 1653
16 Ga0070697_100000593 3300005536 Bacteria 27442
17 Ga0068853_101787711 3300005539 Unclassified 596
18 Ga0070695_100445658 3300005545 Unclassified 991
19 Ga0070696_100109713 3300005546 Bacteria 1986
20 Ga0068855_100090914 3300005563 Bacteria 3521
21 Ga0068864_100629741 3300005618 Bacteria 1043
22 Ga0070717_10481479 3300006028 Bacteria 1121
23 Ga0070717_10879409 3300006028 Bacteria 816
24 Ga0070717_11153132 3300006028 Bacteria 706
25 Ga0075363_100999722 3300006048 Unclassified 515
26 Ga0075364_10012289 3300006051 Bacteria 5235
27 Ga0070716_100162547 3300006173 Bacteria 1448
28 Ga0070712_100611014 3300006175 Bacteria 924
29 Ga0075367_10014739 3300006178 Bacteria 4233
30 Ga0075367_10028639 3300006178 Bacteria 3179
31 Ga0075366_10030689 3300006195 Bacteria 3161
32 Ga0075370_10018075 3300006353 Bacteria 3820
33 Ga0075434_101516534 3300006871 Bacteria 679
34 Ga0075435_100574084 3300007076 Bacteria 977
35 Ga0105240_10006976 3300009093 Bacteria 16497
36 Ga0111539_10000027 3300009094 Bacteria 185408
37 Ga0111539_11434823 3300009094 Bacteria 801
38 Ga0105245_10168054 3300009098 Bacteria 2087
39 Ga0105245_12821169 3300009098 Unclassified 538
40 Ga0114129_10221352 3300009147 Bacteria 2553
41 Ga0114129_11473212 3300009147 Unclassified 837
42 Ga0114129_12275970 3300009147 Unclassified 651
43 Ga0105243_11379612 3300009148 Bacteria 725
44 Ga0105248_12256288 3300009177 Bacteria 620
45 Ga0105237_10059740 3300009545 Bacteria 3814
46 Ga0105238_10005370 3300009551 Bacteria 12664
47 Ga0105238_10082080 3300009551 Unclassified 3213
48 Ga0105246_10927896 3300011119 Bacteria 783
49 Ga0157369_10098766 3300013105 Bacteria 3112
50 Ga0157378_10092254 3300013297 Unclassified 2755
51 Ga0157378_10514094 3300013297 Unclassified 1198
52 Ga0163163_10435538 3300014325 Bacteria 1370
53 Ga0157380_10058077 3300014326 Bacteria 3083
54 Ga0163161_10006749 3300017792 Bacteria 7932
55 Ga0213872_10034748 3300021361 Bacteria 2306
56 Ga0207682_10031126 3300025893 Bacteria 2140
57 Ga0207707_10313433 3300025912 Bacteria 1355
58 Ga0207707_10937395 3300025912 Unclassified 714
59 Ga0207695_10138690 3300025913 Bacteria 2383
60 Ga0207693_10719873 3300025915 Bacteria 772
61 Ga0207657_11089199 3300025919 Unclassified 611
62 Ga0207649_10799865 3300025920 Unclassified 736
63 Ga0207652_10513235 3300025921 Bacteria 1079
64 Ga0207694_10059785 3300025924 Unclassified 2965
65 Ga0207694_10792668 3300025924 Unclassified 800
66 Ga0207700_10439827 3300025928 Bacteria 1148
67 Ga0207700_11298888 3300025928 Bacteria 648
68 Ga0207664_10179526 3300025929 Bacteria 1817
69 Ga0207690_11798126 3300025932 Unclassified 512
70 Ga0207706_10149192 3300025933 Bacteria 2056
71 Ga0207665_10607025 3300025939 Unclassified 855
72 Ga0207667_10029876 3300025949 Bacteria 5904
73 Ga0207667_10057468 3300025949 Unclassified 4084
74 Ga0207639_10076086 3300026041 Bacteria 2642
75 Ga0207639_11367249 3300026041 Unclassified 665
76 Ga0207648_10311178 3300026089 Bacteria 1414
77 Ga0207428_10000447 3300027907 Bacteria 50179
78 Ga0307513_10000072 3300031456 Bacteria 138840
79 Ga0373924_0069904 3300035410 Bacteria 1480
80 Ga0373937_0145169 3300036401 Unclassified 2221
81 Ga0373937_0154695 3300036401 Bacteria 2149
82 Ga0395905_1170013 3300037471 Bacteria 672
83 Ga0436361_0960314 3300039447 Bacteria 3799
84 Ga0451853_1602133 3300041512 Bacteria 687
85 Ga0439446_0108774 3300042156 Bacteria 883
86 Ga0466969_0009682 3300044656 Bacteria 5109
87 Ga0453683_0877140 3300044673 Unclassified 593
88 Ga0466965_0051215 3300044683 Bacteria 2048
89 Ga0466961_0117121 3300044693 Bacteria 1674
90 Ga0453684_0119853 3300044712 Bacteria 3179
91 Ga0453684_1756232 3300044712 Unclassified 632
92 Ga0466957_1185558 3300044842 Bacteria 552
93 Ga0466959_0001139 3300045049 Bacteria 16021
94 Ga0451576_0217686 3300045051 Bacteria 1994
95 Ga0495584_0004007 3300046491 Bacteria 7947
96 Ga0495585_0136139 3300046492 Bacteria 1289
97 Ga0495607_0043245 3300046501 Bacteria 2665
98 Ga0495583_0000506 3300046506 Bacteria 56069
99 Ga0495631_0000391 3300046518 Bacteria 30231
100 Ga0495631_0061100 3300046518 Bacteria 1634
101 Ga0495632_0011507 3300046519 Bacteria 5158
102 Ga0495644_0009568 3300046523 Bacteria 3734
103 Ga0495642_0015621 3300046528 Bacteria 2954
104 Ga0495597_0078492 3300046542 Bacteria 1414
105 Ga0495633_0131173 3300046558 Bacteria 1159
106 Ga0495656_0027117 3300046615 Bacteria 2286
107 Ga0495611_0013599 3300046648 Bacteria 3467
108 Ga0495661_0028321 3300046665 Bacteria 3587
109 Ga0495670_0027464 3300046691 Bacteria 2820
110 Ga0495649_0021829 3300046694 Bacteria 3586
111 Ga0495649_0212726 3300046694 Bacteria 1001
112 Ga0495589_0018114 3300046794 Bacteria 3613
113 Ga0495660_0021417 3300046810 Bacteria 3702
114 Ga0495683_0015742 3300047323 Bacteria 3927
115 Ga0495677_0015870 3300047445 Bacteria 2734
116 Ga0495679_044953 3300047446 Bacteria 1350
117 Ga0495681_0046050 3300047470 Bacteria 2082
118 Ga0495626_0037637 3300048091 Bacteria 2297
119 Ga0495626_0046904 3300048091 Bacteria 2010
120 Ga0496102_0672979 3300048905 Bacteria 958
121 Ga0495678_062586 3300049459 Bacteria 1392
122 Ga0501046_0491090 3300049580 Bacteria 880
123 Ga0501047_0393804 3300049581 Unclassified 1218
124 Ga0501070_0430002 3300049586 Unclassified 1066
125 Ga0501074_0555795 3300049590 Bacteria 812
126 Ga0501044_0048206 3300049823 Bacteria 4402
127 nmdc:mga03683_4237_c1 3300050489 Bacteria 4729
128 nmdc:mga03683_456684_c1 3300050489 Unclassified 615
129 nmdc:mga0k408_179295_c1 3300050493 Bacteria 1263
130 nmdc:mga0k408_18174_c1 3300050493 Bacteria 3922
131 nmdc:mga0k408_53902_c1 3300050493 Unclassified 1561
132 nmdc:mga06z11_8654_c1 3300050494 Bacteria 4257
133 nmdc:mga04h51_444328_c1 3300050495 Bacteria 548
134 nmdc:mga07m45_767092_c1 3300050496 Bacteria 553
135 nmdc:mga05p37_1082335_c1 3300050507 Bacteria 842
136 nmdc:mga05p37_1091332_c1 3300050507 Unclassified 837
137 nmdc:mga08y16_709_c1 3300050511 Bacteria 31626
138 nmdc:mga0n895_819092_c1 3300050512 Bacteria 920
139 nmdc:mga0a205_152864_c2 3300050515 Bacteria 1392
140 Ga0500568_0259110 3300053139 Unclassified 633
141 Ga0500604_0046404 3300053151 Bacteria 1329
142 3003000412 3002998708 Bacteria 11715108
143 Ga0075368_10008536
144 rootH1_10007553
145 rootH2_10085607
146 rootL2_10112634
147 rootL2_10314753
148 Ga0065712_10235727
149 Ga0070682_100006472
150 Ga0070660_100741745
151 Ga0070709_10307389
152 Ga0070714_100124221
153 Ga0070714_100799021
154 Ga0070681_10270419
155 Ga0070681_10454107
156 Ga0070685_10154687
157 Ga0070679_100270560
158 Ga0070697_100000593
159 Ga0068853_101787711
160 Ga0070695_100445658
161 Ga0070696_100109713
162 Ga0068855_100090914
163 Ga0068864_100629741
164 Ga0070717_10481479
165 Ga0070717_10879409
166 Ga0070717_11153132
167 Ga0075363_100999722
168 Ga0075364_10012289
169 Ga0070716_100162547
170 Ga0070712_100611014
171 Ga0075367_10014739
172 Ga0075367_10028639
173 Ga0075366_10030689
174 Ga0075370_10018075
175 Ga0075434_101516534
176 Ga0075435_100574084
177 Ga0105240_10006976
178 Ga0111539_10000027
179 Ga0111539_11434823
180 Ga0105245_10168054
181 Ga0105245_12821169
182 Ga0114129_10221352
183 Ga0114129_11473212
184 Ga0114129_12275970
185 Ga0105243_11379612
186 Ga0105248_12256288
187 Ga0105237_10059740
188 Ga0105238_10005370
189 Ga0105238_10082080
190 Ga0105246_10927896
191 Ga0157369_10098766
192 Ga0157378_10092254
193 Ga0157378_10514094
194 Ga0163163_10435538
195 Ga0157380_10058077
196 Ga0163161_10006749
197 Ga0213872_10034748
198 Ga0207682_10031126
199 Ga0207707_10313433
200 Ga0207707_10937395
201 Ga0207695_10138690
202 Ga0207693_10719873
203 Ga0207657_11089199
204 Ga0207649_10799865
205 Ga0207652_10513235
206 Ga0207694_10059785
207 Ga0207694_10792668
208 Ga0207700_10439827
209 Ga0207700_11298888
210 Ga0207664_10179526
211 Ga0207690_11798126
212 Ga0207706_10149192
213 Ga0207665_10607025
214 Ga0207667_10029876
215 Ga0207667_10057468
216 Ga0207639_10076086
217 Ga0207639_11367249
218 Ga0207648_10311178
219 Ga0207428_10000447
220 Ga0307513_10000072
221 Ga0373924_0069904
222 Ga0373937_0145169
223 Ga0373937_0154695
224 Ga0395905_1170013
225 Ga0436361_0960314
226 Ga0451853_1602133
227 Ga0439446_0108774
228 Ga0466969_0009682
229 Ga0453683_0877140
230 Ga0466965_0051215
231 Ga0466961_0117121
232 Ga0453684_0119853
233 Ga0453684_1756232
234 Ga0466957_1185558
235 Ga0466959_0001139
236 Ga0451576_0217686
237 Ga0495584_0004007
238 Ga0495585_0136139
239 Ga0495607_0043245
240 Ga0495583_0000506
241 Ga0495631_0000391
242 Ga0495631_0061100
243 Ga0495632_0011507
244 Ga0495644_0009568
245 Ga0495642_0015621
246 Ga0495597_0078492
247 Ga0495633_0131173
248 Ga0495656_0027117
249 Ga0495611_0013599
250 Ga0495661_0028321
251 Ga0495670_0027464
252 Ga0495649_0021829
253 Ga0495649_0212726
254 Ga0495589_0018114
255 Ga0495660_0021417
256 Ga0495683_0015742
257 Ga0495677_0015870
258 Ga0495679_044953
259 Ga0495681_0046050
260 Ga0495626_0037637
261 Ga0495626_0046904
262 Ga0496102_0672979
263 Ga0495678_062586
264 Ga0501046_0491090
265 Ga0501047_0393804
266 Ga0501070_0430002
267 Ga0501074_0555795
268 Ga0501044_0048206
269 nmdc:mga03683_4237_c1
270 nmdc:mga03683_456684_c1
271 nmdc:mga0k408_179295_c1
272 nmdc:mga0k408_18174_c1
273 nmdc:mga0k408_53902_c1
274 nmdc:mga06z11_8654_c1
275 nmdc:mga04h51_444328_c1
276 nmdc:mga07m45_767092_c1
277 nmdc:mga05p37_1082335_c1
278 nmdc:mga05p37_1091332_c1
279 nmdc:mga08y16_709_c1
280 nmdc:mga0n895_819092_c1
281 nmdc:mga0a205_152864_c2
282 Ga0500568_0259110
283 Ga0500604_0046404
284 3003000412

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f2d-assembly1.cif.gz_A dna polymerase polc from geobacillus kaustophilus complex with dna, dgtp, mn and zn 0.665 15 39
7zxk-assembly2.cif.gz_D human il-27 in complex with neutralizing srf388 fab fragment 0.6578 14 43
7zxk-assembly1.cif.gz_B human il-27 in complex with neutralizing srf388 fab fragment 0.6499 14 43
5npk-assembly1.cif.gz_D 1.98a structure of thiophene1 with s.aureus dna gyrase and dna 0.6206 15 108
5cdp-assembly1.cif.gz_A 2.45a structure of etoposide with s.aureus dna gyrase and dna 0.6083 15 108
ID Description Score Start End Superfamily
af_I1JF51_69_196_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7125 15 37 2.40.50.140
af_Q8LJL5_19_119_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6655 16 40 2.60.40.10
3f2dA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.665 15 39 2.40.50.140
af_Q2G112_1_115_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6555 15 37 2.40.50.140
af_G5EGJ9_229_322_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6426 15 41 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7X4WG30-F1-model_v4 Uncharacterized protein 0.9634 2 119
AF-A0A5J6MKE3-F1-model_v4 IrrE N-terminal-like domain-containing protein 0.96 2 121
AF-A0A354J0J3-F1-model_v4 Uncharacterized protein 0.9568 1 121
AF-A0A1H7EMA8-F1-model_v4 Uncharacterized protein 0.9563 2 120
AF-A0A354J0J3-F1-model_v4 Uncharacterized protein 0.9491 1 121

Map