F184439

General Info

Members Datasets Scaffolds Average Seq Length
142 100 130 313

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10119587|rootH1_101195875
Length 325
Sequence MKIGIDIMGGDYAPEEAIKGVISYLTANAGTGADVHFMLIGNPDLAAPYLSLLDAWQSHYTLVPSATVIGMHEHPTKALKEKQDSSIAIGFGLLQAGRIDAFFSAGNTGAMLVGAMYTVKAIPGVLRPTIASPIPKLDGKYNFLLDVGANADCKPEHLVQFALMGSLYAKHILNLDNPRVGLLNLGEEEGKGNILAQATYPLLKQHSGIHFIGNVEGRDLFLNNCDVIVCEGFTGNVALKMAESIYNIFTENRKINDDFLEQFNYEIYGGTPILGVNAPVLIGHGISNARAFRSMIESAIKLVSSNFTEILRNSFAGTAEVSLEK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
3 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
4 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
5 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
6 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
7 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
8 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
9 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
10 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
11 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
12 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
13 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
44 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
53 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
56 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
57 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
58 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
59 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
60 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
61 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
63 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
66 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
67 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
73 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
74 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
75 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
76 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
77 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
78 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
79 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
80 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
81 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
82 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
83 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
84 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
85 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
86 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
87 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
88 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
89 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
90 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
91 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
92 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
93 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
95 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
96 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
97 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
98 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
99 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
100 646564506 Arcobacter nitrofigilis DSM 7299 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.21
Metatranscriptomes 6.34
Isolates 8.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.15
Nodule 0
Rhizoplane 0.7
Rhizosphere 78.17
Stem 0
Stem Tuber 0
Unclassified 11.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_459248 2162886007 Bacteria 1904
2 JGI24741J21665_1005823 3300001915 Bacteria 2530
3 JGI24737J22298_10000158 3300001990 Bacteria 21334
4 JGI25162J39368_1000408 3300002737 Bacteria 35183
5 rootL2_10077383 3300003322 Bacteria 5923
6 rootL2_10104998 3300003322 Bacteria 1918
7 rootL2_10146057 3300003322 Bacteria 3923
8 rootH1_10031539 3300003323 Bacteria 15372
9 rootH1_10119587 3300003323 Bacteria 8075
10 rootH1_10155602 3300003323 Bacteria 2223
11 rootH1_10306231 3300003323 Bacteria 1282
12 Ga0065714_10005863 3300005288 Bacteria 5624
13 Ga0065704_10000499 3300005289 Bacteria 28532
14 Ga0070658_10255148 3300005327 Bacteria 1488
15 Ga0070660_100137934 3300005339 Bacteria 1955
16 Ga0070659_100000120 3300005366 Bacteria 59172
17 Ga0068855_100000199 3300005563 Bacteria 77676
18 Ga0068856_100000021 3300005614 Bacteria 145017
19 Ga0075366_10000267 3300006195 Bacteria 23116
20 Ga0075366_10002894 3300006195 Bacteria 8912
21 Ga0075370_10045674 3300006353 Bacteria 2478
22 Ga0075370_10051640 3300006353 Bacteria 2332
23 Ga0105240_10032936 3300009093 Bacteria 6701
24 Ga0105240_10146819 3300009093 Bacteria 2813
25 Ga0105240_10242667 3300009093 Bacteria 2088
26 Ga0105243_10000018 3300009148 Bacteria 227618
27 Ga0105241_10110294 3300009174 Bacteria 2201
28 Ga0105241_10117029 3300009174 Bacteria 2141
29 Ga0105241_10308751 3300009174 Bacteria 1360
30 Ga0105237_10000805 3300009545 Bacteria 42788
31 Ga0105237_10251710 3300009545 Bacteria 1769
32 Ga0105237_10477864 3300009545 Bacteria 1252
33 Ga0105238_10047639 3300009551 Bacteria 4321
34 Ga0105239_10000095 3300010375 Bacteria 124330
35 Ga0157373_10001836 3300013100 Bacteria 16168
36 Ga0157370_10062383 3300013104 Bacteria 3535
37 Ga0157370_10108824 3300013104 Bacteria 2591
38 Ga0157374_10001750 3300013296 Bacteria 18236
39 Ga0157378_10004996 3300013297 Bacteria 11637
40 Ga0157378_10417465 3300013297 Bacteria 1325
41 Ga0163162_10528301 3300013306 Bacteria 1309
42 Ga0157372_10311304 3300013307 Bacteria 1833
43 Ga0157375_10208729 3300013308 Bacteria 2110
44 Ga0182006_1014236 3300015261 Bacteria 3432
45 Ga0163161_10104047 3300017792 Bacteria 2116
46 Ga0163161_10441614 3300017792 Bacteria 1050
47 Ga0206351_10913706 3300020077 Bacteria 3379
48 Ga0209026_1000199 3300025250 Bacteria 83231
49 Ga0209026_1006305 3300025250 Bacteria 2937
50 Ga0209455_1002739 3300025272 Bacteria 6614
51 Ga0207705_10094136 3300025909 Bacteria 2196
52 Ga0207705_10283952 3300025909 Bacteria 1267
53 Ga0207695_10093783 3300025913 Bacteria 3011
54 Ga0207695_10290319 3300025913 Bacteria 1528
55 Ga0207695_10436586 3300025913 Bacteria 1193
56 Ga0207671_10206739 3300025914 Bacteria 1534
57 Ga0207690_10000133 3300025932 Bacteria 60426
58 Ga0207709_10000021 3300025935 Bacteria 386722
59 Ga0207667_10253282 3300025949 Bacteria 1801
60 Ga0207702_10110721 3300026078 Bacteria 2441
61 Ga0307515_10003151 3300028794 Bacteria 34898
62 Ga0265327_10000469 3300031251 Bacteria 71527
63 Ga0307408_100002832 3300031548 Bacteria 12031
64 Ga0307408_100244533 3300031548 Bacteria 1476
65 Ga0316576_10002855 3300031727 Bacteria 9960
66 Ga0316576_10108961 3300031727 Bacteria 2075
67 Ga0316577_10084387 3300031733 Unclassified 1777
68 Ga0316577_10124045 3300031733 Unclassified 1452
69 Ga0307412_10249865 3300031911 Bacteria 1376
70 Ga0307414_10011254 3300032004 Bacteria 5238
71 Ga0307414_10013015 3300032004 Bacteria 4941
72 Ga0307414_10025905 3300032004 Bacteria 3765
73 Ga0307414_10247094 3300032004 Bacteria 1480
74 Ga0307411_10078683 3300032005 Bacteria 2261
75 Ga0316585_10026830 3300032137 Bacteria 1794
76 Ga0316593_10001947 3300032168 Bacteria 4742
77 Ga0316593_10005459 3300032168 Bacteria 3356
78 Ga0316593_10006412 3300032168 Bacteria 3171
79 Ga0316593_10007272 3300032168 Bacteria 3032
80 Ga0316593_10013600 3300032168 Bacteria 2413
81 Ga0307507_10000144 3300033179 Bacteria 123842
82 Ga0316587_1008987 3300033529 Unclassified 1581
83 Ga0316596_1003786 3300033541 Bacteria 3345
84 Ga0316574_0048338 3300035398 Bacteria 2642
85 Ga0316574_0055006 3300035398 Bacteria 2487
86 Ga0316574_0237208 3300035398 Unclassified 1166
87 Ga0316582_0009257 3300036647 Bacteria 5337
88 Ga0316584_0018402 3300036712 Bacteria 5040
89 Ga0316584_0245332 3300036712 Unclassified 1310
90 Ga0395905_0494651 3300037471 Bacteria 1123
91 Ga0400483_009503 3300039062 Bacteria 57988
92 Ga0451577_0081524 3300042876 Bacteria 2886
93 Ga0451577_0134968 3300042876 Bacteria 2216
94 Ga0453684_0123050 3300044712 Bacteria 3128
95 Ga0453684_0253625 3300044712 Unclassified 2019
96 Ga0495651_0230737 3300046462 Bacteria 1275
97 Ga0495585_0000111 3300046492 Bacteria 87559
98 Ga0495608_0173634 3300046511 Bacteria 1366
99 Ga0495616_0000433 3300046513 Bacteria 31968
100 Ga0495631_0098971 3300046518 Bacteria 1255
101 Ga0495632_0102810 3300046519 Bacteria 1346
102 Ga0495648_0018104 3300046524 Bacteria 5007
103 Ga0495648_0051334 3300046524 Bacteria 2514
104 Ga0495652_0158104 3300046529 Bacteria 1763
105 Ga0495654_0070593 3300046530 Bacteria 1656
106 Ga0495609_0009269 3300046538 Bacteria 4769
107 Ga0495609_0017096 3300046538 Bacteria 3372
108 Ga0495633_0000004 3300046558 Bacteria 370781
109 Ga0495668_0000011 3300046616 Bacteria 472186
110 Ga0495668_0000453 3300046616 Bacteria 52477
111 Ga0495625_0001578 3300046660 Bacteria 27104
112 Ga0495625_0006112 3300046660 Bacteria 10789
113 Ga0495625_0037900 3300046660 Bacteria 3532
114 Ga0495658_0197394 3300046683 Bacteria 1253
115 Ga0495686_0000306 3300047472 Bacteria 83341
116 Ga0495686_0000577 3300047472 Bacteria 51975
117 Ga0496115_0247452 3300048918 Bacteria 1468
118 Ga0496116_0002809 3300048919 Bacteria 17884
119 Ga0496117_0005814 3300048920 Bacteria 12778
120 Ga0496123_0019837 3300048926 Bacteria 5279
121 Ga0495678_014019 3300049459 Bacteria 3740
122 Ga0495682_0020310 3300049460 Bacteria 2494
123 Ga0501315_004179 3300049531 Bacteria 1493
124 nmdc:mga0k408_83_c1 3300050493 Bacteria 44610
125 nmdc:mga07m45_58955_c1 3300050496 Bacteria 2172
126 nmdc:mga07m45_83157_c1 3300050496 Bacteria 1829
127 Ga0500616_0000698 3300053153 Bacteria 39124
128 Ga0500622_0000465 3300053156 Bacteria 38456
129 Ga0500624_000721 3300053157 Bacteria 8255
130 Ga0500627_0072258 3300053158 Bacteria 1529

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035398 Ga0316574_0048338 Ga0316574_0048338_1746_2597 281
2 iso_pu_bacteria 2887375801 2887377228 298
3 3300006353 Ga0075370_10045674 Ga0075370_100456742 304
4 3300006353 Ga0075370_10051640 Ga0075370_100516404 304
5 3300036647 Ga0316582_0009257 Ga0316582_0009257_3095_4018 305
6 3300048918 Ga0496115_0247452 Ga0496115_0247452_387_1322 305
7 iso_pu_bacteria 646564506 646814976 305
8 3300032168 Ga0316593_10001947 Ga0316593_100019474 307
9 3300032168 Ga0316593_10005459 Ga0316593_100054593 307
10 3300032168 Ga0316593_10006412 Ga0316593_100064122 307
11 3300032168 Ga0316593_10007272 Ga0316593_100072722 307
12 3300033529 Ga0316587_1008987 Ga0316587_10089871 307
13 3300033541 Ga0316596_1003786 Ga0316596_10037863 307
14 iso_pu_bacteria 2721755487 2722726554 308
15 iso_pu_bacteria 2890737413 2890740096 308
16 iso_pu_bacteria 2896317667 2896321184 308
17 iso_pu_bacteria 2896344016 2896345728 308
18 iso_pu_bacteria 2898713307 2898716565 308
19 iso_pu_bacteria 2904780799 2904785632 308
20 iso_pu_bacteria 2919177583 2919182350 308
21 iso_pu_bacteria 2919437846 2919439421 308
22 iso_pu_bacteria 3003233435 3003235184 308
23 3300009093 Ga0105240_10146819 Ga0105240_101468192 311
24 3300009545 Ga0105237_10477864 Ga0105237_104778641 311
25 3300013104 Ga0157370_10062383 Ga0157370_100623834 311
26 3300025250 Ga0209026_1006305 Ga0209026_10063054 311
27 3300025913 Ga0207695_10093783 Ga0207695_100937832 311
28 3300025914 Ga0207671_10206739 Ga0207671_102067392 311
29 3300031727 Ga0316576_10108961 Ga0316576_101089612 311
30 3300032137 Ga0316585_10026830 Ga0316585_100268303 311
31 3300032168 Ga0316593_10013600 Ga0316593_100136002 311
32 3300035398 Ga0316574_0055006 Ga0316574_0055006_1346_2287 311
33 3300050496 nmdc:mga07m45_58955_c1 nmdc:mga07m45_58955_c1_1010_1945 311
34 3300050496 nmdc:mga07m45_83157_c1 nmdc:mga07m45_83157_c1_569_1504 311
35 2162886007 SwRhRL2b_contig_459248 SwRhRL2b_0739.00000180 312
36 3300001915 JGI24741J21665_1005823 JGI24741J21665_10058233 312
37 3300001990 JGI24737J22298_10000158 JGI24737J22298_1000015810 312
38 3300002737 JGI25162J39368_1000408 JGI25162J39368_100040817 312
39 3300003322 rootL2_10077383 rootL2_100773834 312
40 3300003322 rootL2_10104998 rootL2_101049982 312
41 3300003322 rootL2_10146057 rootL2_101460574 312
42 3300003323 rootH1_10031539 rootH1_100315396 312
43 3300003323 rootH1_10119587 rootH1_101195875 312
44 3300003323 rootH1_10155602 rootH1_101556023 312
45 3300003323 rootH1_10306231 rootH1_103062311 312
46 3300005288 Ga0065714_10005863 Ga0065714_100058636 312
47 3300005289 Ga0065704_10000499 Ga0065704_100004992 312
48 3300005327 Ga0070658_10255148 Ga0070658_102551482 312
49 3300005339 Ga0070660_100137934 Ga0070660_1001379342 312
50 3300005366 Ga0070659_100000120 Ga0070659_10000012034 312
51 3300005563 Ga0068855_100000199 Ga0068855_10000019910 312
52 3300005614 Ga0068856_100000021 Ga0068856_1000000213 312
53 3300006195 Ga0075366_10000267 Ga0075366_100002676 312
54 3300006195 Ga0075366_10002894 Ga0075366_100028944 312
55 3300009093 Ga0105240_10032936 Ga0105240_100329366 312
56 3300009093 Ga0105240_10242667 Ga0105240_102426672 312
57 3300009148 Ga0105243_10000018 Ga0105243_10000018147 312
58 3300009174 Ga0105241_10110294 Ga0105241_101102942 312
59 3300009174 Ga0105241_10117029 Ga0105241_101170292 312
60 3300009174 Ga0105241_10308751 Ga0105241_103087512 312
61 3300009545 Ga0105237_10000805 Ga0105237_1000080530 312
62 3300009545 Ga0105237_10251710 Ga0105237_102517103 312
63 3300009551 Ga0105238_10047639 Ga0105238_100476394 312
64 3300010375 Ga0105239_10000095 Ga0105239_1000009596 312
65 3300013100 Ga0157373_10001836 Ga0157373_100018364 312
66 3300013104 Ga0157370_10108824 Ga0157370_101088244 312
67 3300013296 Ga0157374_10001750 Ga0157374_100017504 312
68 3300013297 Ga0157378_10004996 Ga0157378_100049968 312
69 3300013297 Ga0157378_10417465 Ga0157378_104174652 312
70 3300013306 Ga0163162_10528301 Ga0163162_105283012 312
71 3300013307 Ga0157372_10311304 Ga0157372_103113042 312
72 3300013308 Ga0157375_10208729 Ga0157375_102087293 312
73 3300015261 Ga0182006_1014236 Ga0182006_10142364 312
74 3300017792 Ga0163161_10104047 Ga0163161_101040471 312
75 3300017792 Ga0163161_10441614 Ga0163161_104416141 312
76 3300020077 Ga0206351_10913706 Ga0206351_109137063 312
77 3300025250 Ga0209026_1000199 Ga0209026_100019917 312
78 3300025272 Ga0209455_1002739 Ga0209455_10027393 312
79 3300025909 Ga0207705_10094136 Ga0207705_100941362 312
80 3300025909 Ga0207705_10283952 Ga0207705_102839522 312
81 3300025913 Ga0207695_10290319 Ga0207695_102903191 312
82 3300025913 Ga0207695_10436586 Ga0207695_104365862 312
83 3300025932 Ga0207690_10000133 Ga0207690_1000013347 312
84 3300025935 Ga0207709_10000021 Ga0207709_1000002149 312
85 3300025949 Ga0207667_10253282 Ga0207667_102532822 312
86 3300026078 Ga0207702_10110721 Ga0207702_101107211 312
87 3300028794 Ga0307515_10003151 Ga0307515_1000315131 312
88 3300031251 Ga0265327_10000469 Ga0265327_1000046935 312
89 3300031548 Ga0307408_100002832 Ga0307408_10000283213 312
90 3300031548 Ga0307408_100244533 Ga0307408_1002445332 312
91 3300031727 Ga0316576_10002855 Ga0316576_1000285510 312
92 3300031733 Ga0316577_10084387 Ga0316577_100843872 312
93 3300031733 Ga0316577_10124045 Ga0316577_101240453 312
94 3300031911 Ga0307412_10249865 Ga0307412_102498651 312
95 3300032004 Ga0307414_10011254 Ga0307414_100112543 312
96 3300032004 Ga0307414_10013015 Ga0307414_100130153 312
97 3300032004 Ga0307414_10025905 Ga0307414_100259052 312
98 3300032004 Ga0307414_10247094 Ga0307414_102470941 312
99 3300032005 Ga0307411_10078683 Ga0307411_100786831 312
100 3300033179 Ga0307507_10000144 Ga0307507_1000014445 312
101 3300035398 Ga0316574_0237208 Ga0316574_0237208_159_1103 312
102 3300036712 Ga0316584_0018402 Ga0316584_0018402_2048_2992 312
103 3300036712 Ga0316584_0245332 Ga0316584_0245332_335_1279 312
104 3300037471 Ga0395905_0494651 Ga0395905_0494651_69_1007 312
105 3300039062 Ga0400483_009503 Ga0400483_009503_8762_9700 312
106 3300042876 Ga0451577_0081524 Ga0451577_0081524_1794_2735 312
107 3300042876 Ga0451577_0134968 Ga0451577_0134968_96_1037 312
108 3300044712 Ga0453684_0123050 Ga0453684_0123050_766_1710 312
109 3300044712 Ga0453684_0253625 Ga0453684_0253625_631_1572 312
110 3300046462 Ga0495651_0230737 Ga0495651_0230737_239_1180 312
111 3300046492 Ga0495585_0000111 Ga0495585_0000111_75326_76264 312
112 3300046511 Ga0495608_0173634 Ga0495608_0173634_336_1274 312
113 3300046513 Ga0495616_0000433 Ga0495616_0000433_28864_29802 312
114 3300046518 Ga0495631_0098971 Ga0495631_0098971_88_1026 312
115 3300046519 Ga0495632_0102810 Ga0495632_0102810_150_1088 312
116 3300046524 Ga0495648_0018104 Ga0495648_0018104_469_1407 312
117 3300046524 Ga0495648_0051334 Ga0495648_0051334_509_1447 312
118 3300046529 Ga0495652_0158104 Ga0495652_0158104_337_1278 312
119 3300046530 Ga0495654_0070593 Ga0495654_0070593_551_1489 312
120 3300046538 Ga0495609_0009269 Ga0495609_0009269_491_1429 312
121 3300046538 Ga0495609_0017096 Ga0495609_0017096_1519_2457 312
122 3300046558 Ga0495633_0000004 Ga0495633_0000004_328568_329506 312
123 3300046616 Ga0495668_0000011 Ga0495668_0000011_364684_365622 312
124 3300046616 Ga0495668_0000453 Ga0495668_0000453_18652_19632 312
125 3300046660 Ga0495625_0001578 Ga0495625_0001578_6235_7173 312
126 3300046660 Ga0495625_0006112 Ga0495625_0006112_35_973 312
127 3300046660 Ga0495625_0037900 Ga0495625_0037900_1777_2715 312
128 3300046683 Ga0495658_0197394 Ga0495658_0197394_252_1190 312
129 3300047472 Ga0495686_0000306 Ga0495686_0000306_51494_52432 312
130 3300047472 Ga0495686_0000577 Ga0495686_0000577_20227_21201 312
131 3300048919 Ga0496116_0002809 Ga0496116_0002809_909_1847 312
132 3300048920 Ga0496117_0005814 Ga0496117_0005814_11203_12141 312
133 3300048926 Ga0496123_0019837 Ga0496123_0019837_2702_3640 312
134 3300049459 Ga0495678_014019 Ga0495678_014019_2531_3469 312
135 3300049460 Ga0495682_0020310 Ga0495682_0020310_968_1906 312
136 3300049531 Ga0501315_004179 Ga0501315_004179_487_1425 312
137 3300050493 nmdc:mga0k408_83_c1 nmdc:mga0k408_83_c1_28737_29675 312
138 3300053153 Ga0500616_0000698 Ga0500616_0000698_28542_29522 312
139 3300053156 Ga0500622_0000465 Ga0500622_0000465_30851_31789 312
140 3300053157 Ga0500624_000721 Ga0500624_000721_1603_2541 312
141 3300053158 Ga0500627_0072258 Ga0500627_0072258_203_1180 312
142 iso_pu_bacteria 2939664404 2939669342 312

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02504

FA_synthesis

Fatty acid synthesis protein

1

254

0.96

PF02504

FA_synthesis

Fatty acid synthesis protein

252

310

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6a1k-assembly1.cif.gz_B phosphate acyltransferase plsx from b.subtilis 0.9306 1 309
1vi1-assembly1.cif.gz_A crystal structure of a fatty acid/phospholipid synthesis protein 0.9213 1 312
6a1k-assembly1.cif.gz_B phosphate acyltransferase plsx from b.subtilis 0.919 1 309
1vi1-assembly1.cif.gz_A crystal structure of a fatty acid/phospholipid synthesis protein 0.9185 1 312
1vi1-assembly2.cif.gz_B crystal structure of a fatty acid/phospholipid synthesis protein 0.9168 1 309
ID Description Score Start End Superfamily
af_P27247_3_343_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9253 1 309 3.40.718.10
af_P27247_3_343_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9139 1 309 3.40.718.10
1u7nB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8899 3 310 3.40.718.10
1u7nB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8815 3 310 3.40.718.10
2af3D02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isocitrate/Isopropylmalate dehydrogenase-like 0.7685 121 240 3.40.50.10750
ID Description Score Start End GO Terms
AF-A0A1G4U268-F1-model_v4 Phosphate acyltransferase (EC 2.3.1.274) (Acyl-ACP phosphotransacylase) (Acyl-[acyl-carrier-protein]--phosphate acyltransferase) (Phosphate-acyl-ACP acyltransferase) 0.9902 1 312 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A1W9QQX5-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.9872 127 230 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A1J5P9Z7-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.9841 143 312 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A380E122-F1-model_v4 Phosphate acyltransferase (EC 2.3.1.274) (Acyl-ACP phosphotransacylase) (Acyl-[acyl-carrier-protein]--phosphate acyltransferase) (Phosphate-acyl-ACP acyltransferase) 0.9824 88 227 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A3C0IPK7-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.9814 87 272 GO:0005737
GO:0006633
GO:0008654
GO:0043811

Feature Viewer

pLDDT pTM Quality
92.14 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map